head 1.2; access; symbols netbsd-9-4-RELEASE:1.1.1.1 netbsd-9-3-RELEASE:1.1.1.1 xkeyboard-config-2-34:1.1.1.6 xkeyboard-config-2-33:1.1.1.5 netbsd-9-2-RELEASE:1.1.1.1 xkeyboard-config-2-32:1.1.1.4 xkeyboard-config-2-31:1.1.1.3 netbsd-9-1-RELEASE:1.1.1.1 xkeyboard-config-2-29:1.1.1.2 netbsd-9-0-RELEASE:1.1.1.1 netbsd-9-0-RC2:1.1.1.1 netbsd-9-0-RC1:1.1.1.1 netbsd-9:1.1.1.1.0.2 netbsd-9-base:1.1.1.1 xkeyboard-config-2-27:1.1.1.1 xorg:1.1.1; locks; strict; comment @# @; 1.2 date 2022.10.17.07.38.17; author mrg; state dead; branches; next 1.1; commitid hqYy6FYuC0j5K2YD; 1.1 date 2019.06.01.07.11.07; author mrg; state Exp; branches 1.1.1.1; next ; commitid i9o0lUmZxSk2gspB; 1.1.1.1 date 2019.06.01.07.11.07; author mrg; state Exp; branches; next 1.1.1.2; commitid i9o0lUmZxSk2gspB; 1.1.1.2 date 2020.02.23.11.13.33; author mrg; state Exp; branches; next 1.1.1.3; commitid VwYYnhsQHXI61NXB; 1.1.1.3 date 2020.11.01.12.00.14; author mrg; state Exp; branches; next 1.1.1.4; commitid 75Iv0Ep30piUabuC; 1.1.1.4 date 2021.04.27.03.09.38; author mrg; state Exp; branches; next 1.1.1.5; commitid zAbjQgmRfqh8ySQC; 1.1.1.5 date 2021.07.11.00.08.23; author mrg; state Exp; branches; next 1.1.1.6; commitid 4TD9dT65ykou8v0D; 1.1.1.6 date 2022.01.09.09.50.11; author mrg; state Exp; branches; next ; commitid 6yAJzD1py3KmvWnD; desc @@ 1.2 log @merge xkeyboard-config 2.37. @ text @z#G__q__0`!`````a a 7a DaQaqa-uaa-a$ab/b ?b MbWb ib%ub$b%bbbcccC!c"ecc)c&cc dd d *d4dIdQdYdadyddddFd eee-eDeUeie|e eeeeeeeW fYafffffg!g5g4Hg }gggggg gggh h h )h5h >h Hh Sh+]h hThhhh"i)iCi[isii i iiiiiij+j:j"Wjzjj jjjjj(k9k,Yk#k#kkk#k"l8lXlrlll$l?l%m6m$>mcm%ymmm mm m nn"nAn`nn n n nJn>,oEkooooo9p.?p@@np@@pGpT8q"qqqqqrr3rPrnrrrrr rrrr r rss,s?sYssss sssst t:t%Ct$it!tt+t-t %u3u FuQuWu"fuu"uuuuv"v)v9v Lvmvvvvvvvvw(w Bw Ow\wpwwwwwwwwwx*x#Bxfx{xxx$xAx;y.Ty(yyyy'yz2zQzazyzzzzzz{"{ 9{F{\{)q{{{%{{#| 7|D|c|~||3|@@|#$}H}(Z}}%}}4}~#~ 3~=~X~3u~~~~$~. H R \ fp$!(%!Gd~π ׀"4T'c%$2<o)т .BSi~""(  /=P !Ԅ# )0Zp…Յ&2Yt ҆)E$d  ƇӇ *>Ndy""و( % 1Rf0ۉ  /@@Ugv   ˊي (5G`&ċ"'Gg nj،  &))P$z'&Ǎ)$'=&e)$'ێ&)*$T'y͏ .N k ݐ!3 S]ci"đ 0>GYl|%͒&4;T\ v!&7>FKRrД!3Ogzĕ #!E MYp(–"+HY)x-З8!Tv 4ۘD HS\eu7ۙ*@@ T_|.()2B \} #!( -+N%zȜ'-BR%q) ϝ ! ; E4S& "О%%"?&b ȟ)ܟ'8>X]l)à֠$ 7Xj &")1"K#n  &̢* #5Yu$# ۣ  $#+#O=sM#M#^qХ%'? U_s#٦Sd1§ ȧ֧ ߧ!(<NTdy ʨ,4=rʩ 3(O,x!!$*A$l٫-3M` v(fì!*%L r}(٭ fmv ®֮$ 8CK es"!!";#^(ݰ &9To!ޱ+( <J\n ʲ"&5Ue} 0ȳ$ 29Jݴ"!#1Uk &Եܵ,!3 U$v&,¶-BY7vη*;Wf*ظ*Gdʹ޹""+Ne{ ȺҺ-/(]"$-2DX`,~++׼/;Cd%- =I[rǾ.*It{ ο '->Nl++;+g ,B(WBc(A jt&KeuoJhoJ#nqtx}  !$'*-0369<?CFILSVY\_behkorux{~ !$|;b)E$\'$'  !A5E {/, , :DV2f(2 W/D$1G#k ' + LRi\ 0AT f t _cM  .F3^ &%. E O[ d n y+]#+3"Be %:Rg$x$ &A/_#."&, G)Q&{%/(PX9&&)Pgx$ 3!H j LLZ0$MDN[XVHN'2#K o# +6GO b o| /;Zy'!#@@@@YI 11c.{!$#$4%Gm'"6R p }  !#EX/a6*P>K61DV$g/ "&?fz'6E |#.+5 R_} 7A ,O|1-! A+m}  F-6H'`-  ! &0N$W!|(% $@@Yu }& >%[#7> &-9Ag.L_s %!&Gn(B('@@(h12!7V h&&&)Pk| !/&N'u#'/@@Vl~$%' M&[&2 :Us   (6M]o$w #'>["{; R_p  ,/*-E,s/*-,)/V*-,/ *<-g(&6V s  %*1"D gq y%(!Jfv%&+Rp.w+!;!]$ 5E_u%B[cl' ( ' "F i z   & 2 6 N ]  }  A (   , GD   ]   + A m[ \  & 0 M k      / )CXaq$ #!*7 b+7+'<dt%+ )= ]i 7</,K4x1-4 B_ z/"'6O^$c#( !>P h'")"1"Tw~ *1%&Lj&"     (F/dAAQ6* /C)Z l7RL ":Mg{ %$-@@/R?'),V%k (,!!=&_()# ) B `        !!5,!jb!-!3! /";"5R""" ""m"I#Q#&e####&##$&$6$<$ Z$f$w$$$$$$# %$0%$U%z%%.%%%&#&7&S&o&$&&%&&'.' B'P'c'u'''' '''"')(H( f(t((( (<( )D)b);y)))) ))*(*@@*X*a*1s**)**%*+1+:+L+2h+$+#+2+.,/F,v,,, ,,,U-p-#-----....+F.r.....!.#/"'/"J/m///////&/+!0M0j0 0000 001 11 11,R1+11!1#122 !2+2J2]2c2v2 2292929)3c3{33@@3c3H4\4k444 4444%44 55%5>5[5.x5*5 5"5 5 6"6>6W6m66676k6b7q777777I7BI8+8 88888 992(9[9+p99E9y9Kv::::::;!;@@);Rj;d;_"<@@<_<@@#=d=g=j=n=s=y=~================================>>> >>>>>>!>$>'>*>->0>3>6>9>=>@@>C>F>M>P>S>V>Y>\>_>b>e>i>l>o>r>u>x>{>~>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>??? ?????? zE B\ 9&LeE#gq5>D,DL3d iW%:h0x0tH2&~WFlMJOV6 F[M<o `yCkw (u; <$b* ?"A$9kN #l%=+?I\c.)1/3-.I67U-V3$ 2eR;h`f7JZ U!N-*'"gb+])a{_)ufS-E+^Wx^49i!KYcMA }a)Jd` %mO3}p5^ICqX6 =d*Xv\ oU[s!r0uz&Mg_x:Om'02,nZ=<>%B,jH(+Rp"eCW0h[[Solv8` K*c;KLONGagFt?N1R]7ymL8'7sT,'&LoG}2 <hk|DwHK9_yqs J-k;Fr,cHg|TrqlYP5c@@]6Z`|t#x:T CJG {A/wYv4Yp'/GpI>{}b2 qfE.^rk4"$ ]wj3P#yj! IeG*PzS$dz#Ejjn~fiO/!hm_45RQa)K6F<@@wldnb@@zPv87i@@/WA85[%  nTtR\aStS_9vpiZ"|@@fxDu>DVBU?.>n8:Tm~M^(XQrsB .o1{=ysU&V:Q\4eBXN;=Y1V( 1XH]PCQb~+QZ?u( A <Less/Greater><Less/Greater> chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser<Less/Greater>; acts as onetime lock when pressed together with another 3rd level chooser3rd level of <Less/Greater>3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (alt.)Cherry CyBo@@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (with <\|> key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)EurKEY (US based layout with European letters)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Finnish DvorakFour-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (US, AZERTY)French (US, with French letters)French (US, with French letters, with dead keys, alternative)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianIndonesian (Jawi)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Numeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt as Hangul, right Ctrl as HanjaRight Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Hangul, right Alt as HanjaRight Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+<key>) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French, with Vietnamese letters)Vietnamese (QĐERTY)Vietnamese (US, with Vietnamese letters)ViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.26.99 Report-Msgid-Bugs-To: svu@@users.sourceforge.net POT-Creation-Date: 2019-05-31 00:30+0100 PO-Revision-Date: 2019-05-17 23:45+0200 Last-Translator: Jean-Philippe Guérard Language-Team: French Language: fr MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. Plural-Forms: nplurals=2; plural=(n>=2); <Plus petit/Plus grand><Plus petit/Plus grand> sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveau<Plus petit/Plus grand>, avec un autre sélecteur de niveau 3, enclenche une fois ce niveauNiveau 3 de <Plus petit/Plus grand>Niveau 3 de Verr. Maj.Niveau 3 de la touche Ctrl de gaucheNiveau 3 de la touche Windows de gaucheNiveau 3 de menuNiveau 3 de la touche Ctrl de droiteNiveau 3 de la touche Windows de droiteA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSymboles clavier APL : disposition APL unifiée APLXSymboles clavier APL : IBM APL2Symboles clavier APL : Manugistics APL*PLUS IISymboles clavier APL : disposition unifiéeSymboles APL : saxClavier de type téléphoniqueAcer AirKey VAcer C300Acer Ferrari 4000Acer (portable)Ajouter du comportement standard à la touche MenuAjout des lettres accentuées EspérantoAjout des signes monétaires sur certaines touchesAdvance Scorpius KIAfghanAkanAlbanaisAlbanais (Plisi)Autorise des actions clavier à casser les captures (attention : faille de sécurité)Autorise l'enregistrement des captures et arborescences de fenêtresAlt et Meta sont sur les touches AltAlt est placé sur Windows droite, Super sur MenuAlt est placé sur les touches Windows (et les touches Alt habituelles)Alt échangé avec WindowsAlt+Verr. maj.Alt+CtrlAlt+Maj.Alt+EspaceComportement des touches Alt et WindowsAmhariqueN'importe quelle touche AltN'importe quelle touche WindowsN'importe quelle touche Windows (maintenue)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium : émulation des touches PC (Impr. écr. ; défil. ; pause ; Verr. Num.)Apple (portable)ArabeArabe (azerty)Arabe (azerty/chiffres)Arabe (Algérie)Arabe (Buckwalter)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (qwerty)Arabe (Sun type 6/7)Arabe (Syrie)Arabe (chiffres)Arabe (qwerty/chiffres)Arabe (avec extensions pour l'écriture arabe d'autres langues et chiffres arabes en priorité)Arabe (avec extensions pour l'écriture arabe d'autres langues et chiffres européens en priorité)ArménienArménien (phonétique OLPC)Arménien (variante orientale)Arménien (variante phonétique)Arménien (orientale)Arménien (phonétique)Arménien (occidentale)Asturien (Espagne, avec H point bas et L point bas)Asus (portable)En bas à gaucheÀ gauche du « A »AtsinaAvatimeAvestiqueAzériAzéri (cyrillique)Azona RF2300 clavier internet sans filBTC 5090BTC 5113RF multimédiaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarre oblique inverseLa barre oblique inverse, avec un autre sélecteur de niveau 3, enclenche une fois ce niveauBambaraBengaliBengali (Inde)Bengali (Inde, Inscript Baishakhi)Bengali (Inde, Baishakhi)Bengali (Inde, Bornona)Bengali (Inde, Probhat)Bengali (Inde, Uni Gitanjali)Bengali (Probhat)BachkirBiélorusseBiélorusse (latin)Biélorusse (obsolète)BelgeBelge (Sun type 6/7)Belge (Wang 724 azerty)Belge (variante ISO)Belge (variante)Belge (variante, Latin-9 uniquement)Belge (variante, touches mortes Sun)Belge (sans touche morte)Belge (touches mortes Sun)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbère (Algérie, latin)Berbère (Algérie, Tifinagh)Berbère (Maroc, Tifinagh variante phonétique)Berbère (Maroc, variante Tifinagh)Berbère (Maroc, Tifinagh étendu phonétique)Berbère (Maroc, Tifinagh étendu)Berbère (Maroc, Tifinagh phonétique)Berbère (Maroc, Tifinagh)BosniaqueBosniaque (US, avec digraphes bosniaques)Bosniaque (US avec lettres bosniaques)Bosniaque (avec digraphes bosniaques)Bosniaque (avec guillemets)Les deux Alt ensembleLes deux Ctrl ensembleLes deux Maj. ensembleLes 2 touches Maj. ensemble activent Verr. maj.Les 2 touches Maj. ensemble activent le Verr. maj., la touche Maj. le désactiveLes 2 touches Maj. ensemble activent le blocage majusculeBrailleBraille (pour gaucher, pouce inversé)Braille (pour gaucher)Braille (pour droiter, pouce inversé)Braille (pour droiter)Brother InternetBulgareBulgare (nouvelle phonétique)Bulgare (phonétique traditionnelle)BirmanBirman ZawgyiCameroun multilingue (azerty)Cameroun multilingue (Dvorak)Cameroun multilingue (qwerty)Canadien multilingueCanadien multilingue (1re partie)Canadien multilingue (2e partie)Verr. maj.Verr. maj. (maintenu), Alt + Verr. maj. joue le rôle original de Verr. maj.Verr. maj. agit comme un verrouillage de maj ; Maj. l'annule temporairementVerr. maj. agit comme Maj. quand il est verrouillé ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj. comme CtrlComportement de la touche Verr. maj.Verr. maj. est également CtrlVerr. maj. est désactivéVerr. maj. (première disposition), Maj. + Verr. maj. (dernière disposition)Verr. maj. bascule le blocage majuscule (affecte toutes les touches)Verr. maj. active ou désactive la mise en majuscule usuelle des caractères alphabétiquesVerr. maj. utilise la mise en majuscule interne ; Maj. annule temporairement Verr. maj.Verr. maj. utilise la mise en majuscule interne ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj., avec un autre sélecteur de niveau 3, enclenche une fois ce niveauCatalan (Espagne, avec L point médian)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (variante)Cherry CyBo@@rd concentrateur USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony internetChicony KB-9885Chicony KU-0108Chicony KU-0108ChinoisChromebookLiturgique slaveChuvashTchouvache (latin)Classmate PCCló GaelachSalish Cœur d'AlèneCompaq Armada (portable)Compaq Easy AccessCompaq Internet (13 touches)Compaq Internet (18 touches)Compaq Internet (7 touches)Compaq Presario (portable)Compaq iPaqCreative Desktop Wireless 7000Tatar de Crimée (Q dobroudja)Tatar de Crimée (Alt-Q turc)Tatar de Crimée (F turc)Tatar de Crimée (Q turc)CroateCroate (US, avec les digraphes croates)Croate (US, avec lettres croates)Croate (avec les digraphes croates)Croate (avec guillemets)Ctrl est placé sur les touches Alt, Alt sur les touches WindowsCtrl est placé sur les touches Windows (et les touches Ctrl habituelles)Position de CtrlCtrl+Alt+Eff. arrièreCtrl+Maj.TchèqueTchèque (qwerty)Tchèque (qwerty, barre oblique inverse étendue)Tchèque (Sun type 6/7)Tchèque (UCW, lettres accentuées uniquement)Tchèque (Dvorak US, support UCW)Tchèque (avec la touche <\|>)Tchèque, slovaque et allemand (US)DTK2000DanoisDanois (Dvorak)Danois (Macintosh)Danois (Macintosh, sans touche morte)Danois (Sun type 6/7)Danois (Touches Windows)Espagnol (sans touche morte)Touches du pavé numérique par défautDellDell PC 101 touchesDell Inspiron 6000/8000 (portable)Dell Latitude (portable)Dell Precision M (portable)Dell Precision M65 (portable)Dell SK-8125Dell SK-8135Dell USB MultimédiaDexxa Wireless DesktopDivehiDiamond 9801/9802NéerlandaisNéerlandais (Macintosh)Danois (Sun type 6/7)Néerlandais (standard)Néerlandais (touches mortes Sun)Dyalog APL completDzongkhaDalécarlien (Suède, avec ogonek combinatoire)Active des caractères typographiques supplémentairesAnglais (Australien)Anglais (Cameroun)Anglais (Canada)Anglais (Carpalx)Anglais (Carpalx, complètement optimisé)Anglais (Carpalx, complètement optimisé, internat., touches mortes via AltGr)Anglais (Carpalx, complètement optimisé, internat., avec touches mortes)Anglais (Carpalx, internat., touches mortes via AltGr)Anglais (Carpalx, internat., avec touches mortes)Anglais (Colemak)Anglais (Dvorak)Anglais (Dvorak, variante internat.)Anglais (Dvorak, internat. avec touches mortes)Anglais (Dvorak, pour gaucher)Anglais (Dvorak pour droitier)Anglais (Ghana)Anglais (Ghana, GILLBT)Anglais (Ghana, multilingue)Anglais (Inde, avec le symbole Roupie)Anglais (Macintosh)Anglais (Mali, US, Macintosh)Anglais (Mali, US, internat.)Anglais (Nigeria)Anglais (Norman)Anglais (Afrique du Sud)Anglais (Royaume-Uni)Anglais (Royaume-Uni, Colemak)Anglais (Royaume-Uni, Dvorak)Anglais (Royaume-Uni, Dvorak, ponctuation britannique)Anglais (Royaume-Uni, Macintosh)Anglais (Royaume-Uni, Sun type 6/7)Anglais (Royaume-Uni, étendu, touche Windows)Anglais (Royaume-Uni, internat., Macintosh)Anglais (Royaume-Uni, internat., avec touches mortes)Anglais (US)Anglais (US, Arabe IBM 238_L)Anglais (US, Sun type 6/7)Anglais (US, variante internat.)Anglais (US, Euro sur le 5)Anglais (US, international, AltGr combinatoire Unicode)Anglais (US, international, AltGr combinatoire Unicode, variante)Anglais (US, internat., avec touches mortes)Anglais (Workman)Anglais (Workman, internat., avec touches mortes)Anglais (Dvorak classique)Anglais (internat., touches mortes via AltGr)Anglais (Dvorak pour programmeur)Anglais (les touches diviser/multiplier basculent la disposition)Ennyah DKB-1008Entrée sur le pavé numériqueEspérantoEspéranto (Brésil, Nativo)Espéranto (Portugal, PT-Nativo)Espéranto (point-virgule et guillemets simples déplacés, obsolète)EstonienEstonien (Dvorak)Estonien (Sun type 6/7)Estonien (US, avec lettres estoniennes)Estonien (sans touche morte)EurKEY (clavier US avec lettres européennes)Euro sur le 2Euro sur le 4Euro sur le 5Euro sur le EEverex STEPnoteÉwéFL90FéroïenFéroïen (sans touche morte)FilipinoFilipino (Capewell-Dvorak, baybayin)Filipino (Capewell-Dvorak, latin)Filipino (Capewell-QWERF 2006, baybayin)Filipino (Capewell-QWERF 2006, latin)Filipino (Colemak, baybayin)Filipino (Colemak, latin)Filipino (Dvorak, baybayin)Filipino (Dvorak, latin)Filipino (qwerty, baybayin)FinnoisFinnois (DAS)Finnois (Macintosh)Finnois (Sun type 6/7)Finnois (Touches Windows)Finnois (classique)Finnois (classique, sans touche morte)Finnois (Dvorak)Touche à quatre niveaux avec le séparateur décimal abstraitTouche à quatre niveaux avec virguleTouche à quatre niveaux avec pointTouche à quatre niveaux avec point, Latin-9 uniquementTouche à quatre niveaux avec le séparateur décimal momayyezFrançaisFrançais (azerty)Français (Bépo, ergonomique, façon Dvorak)Français (Bépo, ergonomique, façon Dvorak, Latin-9 uniquement)Français (breton)Français (Cameroun)Français (Canada)Français (Canada, Dvorak)Français (Canada, obsolète)Français (République démocratique du Congo)Français (Dvorak)Français (Guinée)Français (Macintosh)Français (Mali, variante)Français (Maroc)Français (Sun type 6/7)Français (Suisse)Français (Suisse, Macintosh)Français (Suisse, Sun type 6/7)Français (Suisse, sans touche morte)Français (Suisse, touches mortes Sun)Français (Togo)Français (US, azerty)Français (US, avec lettres françaises)Français (US, avec lettres françaises, touches mortes, variante)Français (variante)Français (variante, Latin-9 uniquement)Français (variante, sans touche morte)Français (variante, touches mortes Sun)Français (variante obsolète)Français (variante obsolète, sans touche morte)Français (variante obsolète, touches mortes Sun)Français (sans touche morte Sun)Français (touches mortes Sun)Frioulan (Italie)Fujitsu-Siemens Amilo (portable)PeulGaPC générique 101 touchesPC générique 102 touches (internat.)PC générique 104 touchesPC générique 105 touches (internat.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGéorgienGéorgien (France, azerty Tskapo)Géorgien (Italie)Géorgien (MESS)Géorgien (ergonomique)AllemandAllemand (Aus der Neo-Welt)Allemand (Autriche)Allemand (Autriche, Macintosh)Allemand (Autriche, sans touche morte)Allemand (Autriche, touches mortes Sun)Allemand (Bone)Allemand (Bone, ß et q échangés)Allemand (Dvorak)Allemand (KOY)Allemand (Macintosh)Allemand (Macintosh, sans touche morte)Allemand (Neo 2)Allemand (Neo qwerty)Allemand (Neo qwertz)Allemand (qwerty)Allemand (Sun type 6/7)Allemand (Suisse)Allemand (Suisse, Macintosh)Allemand (Suisse, Sun type 6/7)Allemand (Suisse, obsolète)Allemand (Suisse, sans touche morte)Allemand (Suisse, touches mortes Sun)Allemand (T3)Allemand (US, avec lettres allemandes)Allemand (accent aigu en touche morte)Allemand (accents aigu et grave en touches mortes)Allemand (tilde en touche morte)Allemand (sans touche morte)Allemand (avec les lettres hongroises, sans touche mortes)Allemand (touches mortes Sun)Allemand (Ladin)GrecGrec (Colemak)Grec (Sun type 6/7)Grec (étendu)Grec (sans touche morte)Grec (polytonique)Grec (simple)GujarâtîGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking pour MacHaoussa (Ghana)Haoussa (Nigeria)HébreuHébreu (biblique, SIL, phonétique)Hébreu (biblique, Tiro)Hébreu (lyx)Hébreu (phonétique)Hewlett-Packard InternetHewlett-Packard Mini 110 (portable)Hewlett-Packard NEC SK-2500 MultimédiaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadécimalHindi (bolnagri)Hindi (phonétique KaGaPa)Hindi (Wx)Honeywell EuroboardHtc DreamHongroisHongrois (101/qwerty/virgule/touches mortes)Hongrois (101/qwerty/virgule/sans touche morte)Hongrois (101/qwerty/point/touches mortes)Hongrois (101/qwerty/point/sans touche morte)Hongrois (101/qwertz/virgule/touches mortes)Hongrois (101/qwertz/virgule/sans touche morte)Hongrois (101/qwertz/point/touches mortes)Hongrois (101/qwertz/point/sans touche morte)Hongrois (102/qwerty/virgule/touches mortes)Hongrois (102/qwerty/virgule/sans touche morte)Hongrois (102/qwerty/point/touches mortes)Hongrois (102/qwerty/point/sans touche morte)Hongrois (102/qwertz/virgule/touches mortes)Hongrois (102/qwertz/virgule/sans touche morte)Hongrois (102/qwertz/point/touches mortes)Hongrois (102/qwertz/point/sans touche morte)Hongrois (qwerty)Hongrois (sans touche morte)Hongrois (standard)Hyper est placé sur les touches WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandaisIslandais (Dvorak)Islandais (Macintosh)Islandais (Macintosh, obsolète)Islandais (sans touche morte)Islandais (touches mortes Sun)IgboIndienIndonésien (jawi)Alphabet phonétique internationalInuktitutIrakienIrlandaisIrlandais (UnicodeExpert)ItalienItalien (IBM 142)Italien (Macintosh)Italien (Sun type 6/7)Italien (US, avec lettres italiennes)Italien (touche Windows)Italien (internat., avec touches mortes)Italien (sans touche morte)Italien (Ladin)JaponaisJaponais (Dvorak)Japonais (Kana 86)Japonais (Kana)Japonais (Macintosh)Japonais (OADG 109A)Japonais (PC-98)Japonais (Sun type 6)Japonais (Sun type 7 - compatible PC)Japonais (Sun type 7 - compatible Sun)Options des claviers japonaisKalmykLa touche « verrouillage Kana » verrouilleKannadaKannada (phonétique KaGaPa)CachoubeKazakhKazakh (latin)Kazakh (étendu)Kazakh (avec russe)Séquence de touches pour tuer le serveur XTouche sélectionnant le niveau 5Touche sélectionnant le niveau 3Keytronic FlexProKhmer (Cambodge)KikuyuKinesisKomiCoréenCoréen (compatible 101/104 touches)Coréen (Sun type 6/7)Touches Hangeul/Hanja coréennesKurde (Iran, arabe-latin)Kurde (Iran, F)Kurde (Iran, Alt-Q latin)Kurde (Iran, Q latin)Kurde (Irak, arabe-latin)Kurde (Irak, F)Kurde (Irak, Alt-Q latin)Kurde (Irak, Q latin)Kurde (Syrie, F)Kurde (Syrie, Alt-Q latin)Kurde (Syrie, Q latin)Kurde (Turquie, F)Kurde (Turquie, Alt-Q latin)Kurde (Turquie, Q latin)KutenaiKirghizeKirghize (phonétique)LaoLao (disposition proposée par la STEA)LettonLetton (F)Letton (Sun type 6/7)Letton (Colemak US)Letton (Colemak US, variante apostrophe)Letton (Dvorak US)Letton (Dvorak US, variante Y)Letton (Dvorak US, variante moins)Letton (adapté)Letton (apostrophe)Letton (ergonomique, ŪGJRMV)Letton (moderne)Letton (Dvorak pour le programmeur US)Letton (Dvorak pour le programmeur US, variante Y)Letton (Dvorak pour le programmeur US, variante moins)Letton (tilde)Disposition du pavé numériqueAlt gaucheAlt gauche (maintenu)Alt. gauche pour Ctrl, Ctrl pour Win, Win gauche pour Alt. gaucheAlt gauche échangé avec Windows gaucheAlt gauche+Maj. gaucheCtrl gaucheCtrl gauche comme MétaCtrl gauche (première disposition), Ctrl droit (dernière disposition)Ctrl gauche+Maj. gaucheCtrl gauche + Windows gaucheCtrl gauche + Windows gauche (première disposition), Ctrl droit + Menu (seconde disposition)Maj. gaucheTouche Windows gaucheWindows gauche (maintenu)Windows gauche sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauTouche Windows gauche (première disposition), touche Windows droite (dernière disposition)ObsolèteWang 724 (clavier obsolète)Touche obsolète avec virguleTouche obsolète avec pointLituanienLituanien (IBM LST 1205-92)Lituanien (LEKP)Lituanien (LEKPa)Lituanien (Sun type 6/7)Lituanien (Dvorak US avec lettres lituaniennes)Lituanien (US, avec lettres lituaniennes)Lituanien (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (variante)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (variante 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTouches supplémentaires Logitech G15 via le démon G15Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bas-sorabeBas-sorabe (qwertz)MacBook/MacBook ProMacBook/MacBook Pro (Internat.)MacédonienMacédonien (sans touche morte)MacintoshMacintosh (ancien)Rester compatible avec les anciens code clavier SolarisFaire de Verr. maj. un Effacement. arrière supplémentaire.Faire de Verr. maj. un Échap. supplémentaire.Faire de Verr. maj. un Hyper supplémentaireFaire de Verr. maj. une touche Menu supplémentaire.Faire de Verr. maj. un Verr. Num. supplémentaireFaire de Verr. maj. un Super supplémentaire.Faire du Zenkaku Hankaku un Échap. supplémentaire.Malais (clavier jawi, arabe)Malais (jawi, phonétique)MalayâlamMalayâlam (lalitha)Malayâlam (Inscript amélioré avec le roupie)MaltaisMaltais (avec disposition US)Meitei (Eeyek)MaoriMarathi (phonétique KaGaPa)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (maintenu), Maj.+Menu pour MenuMenu comme Ctrl droiteMéta est placé sur Windows gaucheMéta est placé sur les touches WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (suédois)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB /Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Clavier Microsoft OfficeMicrosoft Wireless Multimedia 1.0ADiverses options de compatibilitéM'mockMoldaveMoldave (Gagaouze)MongolMonténégrinMonténégrin (cyrillique avec guillemets)Monténégrin (cyrillique)Monténégrin (cyrillique, ZE et ZHE intervertis)Monténégrin (latin avec guillemets)Monténégrin (latin, qwerty)Monténégrin (latin, Unicode)Monténégrin (latin, Unicode, qwerty)Multilingue (Canada, Sun type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Eff. Arr. du type NICOLA-FNépalaisEspace insécable au niveau 2Espace insécable au niveau 3Espace insécable au niveau 3, rien au niveau 4Espace insécable au niveau 3, espace fine insécable au niveau 4Espace insécable au niveau 4Espace insécable au niveau 4, espace fine insécable au niveau 6Espace insécable au niveau 4, espace fine insécable au niveau 6 (via Ctrl+Maj.)Sami du Nord (Finlande)Sami du Nord (Norvège)Sami du Nord (Norvège, sans touche morte)Sami du Nord (Suède)Northgate OmniKey 101NorvégienNorvégien (Colemak)Norvégien (Dvorak)Norvégien (Macintosh)Norvégien (Macintosh, sans touche morte)Norvégien (Sun type 6/7)Norvégien (Touches Windows)Norvégien (sans touche morte)Verr. Num.Verr. num. activé : chiffres ; maj. pour les flèches. Verr. num. désactivé : flèches (comme Windows)Comportement de la touche de Suppr. du pavé numériqueLes touches du pavé numérique sont toujours numériques (comme sur Mac OS)OLPCOccitanOghamOgham (IS434)SantaliRunes HongroisesOriyaOrtek MCK-800 Multimédia/InternetOssète (Géorgie)Ossète (touches Windows)Ossète (obsolète)PC-98Ruthène pannonienPosition des parenthèsesPachtoPachto (Afghanistan, OLPC)PausePersanPersan (Afghanistan, Dari, OLPC)Persan (avec pavé numérique persan)PolonaisPolonais (Colemak)Polonais (Dvorak)Polonais (Dvorak, guillemets polonais sur le 1)Polonais (Dvorak, guillemets polonais sur la touche guillemets)Polonais (Allemagne, sans touche morte)Polonais (glagolitique)Polonais (qwertz)Polonais (Sun type 6/7)Polonais (internat., avec touches mortes)Polonais (obsolète)Polonais (Dvorak pour le programmeur)PortugaisPortugais (Brésil)Portugais (Brésil, Dvorak)Portugais (Brésil, ThinkPad IBM/Lenovo)Portugais (Brésil, Nativo pour claviers US)Portugais (Brésil, Nativo)Portugais (Brésil, Sun type 6/7)Portugais (Brésil, sans touche morte)Portugais (Macintosh)Portugais (Macintosh, sans touche morte)Portugais (Macintosh, touches mortes Sun)Portugais (Nativo pour claviers US)Portugais (PT-Nativo)Portugais (Sun type 6/7)Portugais (sans touche morte)Portugais (touches mortes Sun)Position de la touche ComposePropeller Voyager KTEZ-1000Impr. Écr.Penjabi (Gurmukhî, Jhelum)Penjabi (Gurmukhî)QTronix Scorpius 98N+Alt droiteAlt droite (maintenu)Alt droite pour le Hangeul, Ctrl droite pour le HanjaAlt. droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauAlt droite ne sélectionne jamais le niveau 3Alt droite, Maj. + Alt droite est la touche composeCtrl droiteCtrl droite (maintenu)Ctrl droite pour le Hangeul, Alt droite pour le HanjaCtrl droite comme Alt droiteCtrl droite + Maj. droiteMaj. droiteWindows droiteWindows droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauRoumainRoumain (Allemagne)Roumain (Allemagne, sans touche morte)Roumain (Sun type 6/7)Roumain (touche Windows)Roumain (cédille)Roumain (ergonomique dactylographique)Roumain (standard, cédille)Roumain (standard)Roupie sur le 4RusseRusse (Tchèque, phonétique)Russe (DOS)Russe (Géorgie)Russe (Allemagne, phonétique)Russe (Allemagne, recommandé)Russe (Allemagne, translittération)Russe (Kazakhstan, avec kazakh)Russe (Macintosh)Russe (Pologne, Dvorak phonétique)Russe (polyglotte et réactionnaire)Russe (Rulemak, Colemak phonétique)Russe (Sun type 6/7)Russe (Suède, phonétique)Russe (Suède, phonétique, sans touche morte)Russe (US, phonétique)Russe (Ukraine, RSTU standard)Russe (obsolète)Russe (phonétique)Russe (phonétique, azerty)Russe (phonétique, Dvorak)Russe (phonétique, français)Russe (phonétique, touches Windows)Russe (machine à écrire)Russe (machine à écrire, obsolète)Russe (avec ponctuation US)Russe (Ukrainien-Biélorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taïwan)Samsung SDM 4500PSamsung SDM 4510PSanscrit (phonétique KaGaPa)Sanwa Supply SKB-KG3Arrêt défilementSecwepemctsinPoint-virgule au niveau 3SerbeSerbe (cyrillique avec guillemets)Serbe (cyrillique, ZE et ZHE intervertis)Serbe (Latin avec guillemets)Serbe (Latin)Serbe (Latin, qwerty)Serbe (latin, Unicode)Serbe (latin, Unicode, qwerty)Serbe (Russe)Serbe (accents combinatoires à la place des touches mortes)Serbo-Croate (US)Maj. + VerrNum bascule le contrôle souris au clavier (PointerKeys) Maj. annule Verr. maj.Maj. n'annule pas Verr. num., mais sélectionne le niveau 3Maj.+ Verr. maj.SicilienSicilien (clavier US)SilésienSilvercrest Multimedia WirelessSindhîCingalais (US, avec lettres cingalaises)Cingalais (phonétique)SlovaqueSlovaque (qwerty)Slovaque (qwerty, barre oblique inverse étendue)Slovaque (Sun type 6/7)Slovaque (barre oblique inverse étendue)SlovèneSlovène (US, avec lettres slovènes)Slovène (avec guillemets)EspagnolEspagnol (Dvorak)Espagnol (Amérique latine)Espagnol (Amérique latine, Colemak spécial jeux)Espagnol (Amérique latine, Colemak)Espagnol (Amérique latine, Dvorak)Espagnol (Amérique latine, tilde en touche morte)Espagnol (Amérique latine, sans touche morte)Espagnol (Amérique latine, touches mortes Sun)Espagnol (Macintosh)Espagnol (Sun type 6/7)Espagnol (touches Windows)Espagnol (tilde en touche morte)Espagnol (sans touche morte)Espagnol (touches mortes Sun)Les combinaisons spéciales (Ctrl+Alt+<touche>) sont traitées par le serveur XSteelSeries Apex 300 (Apex RAW)Compatibilité avec les touches SunSun type 6 (Japon)Sun type 6 USB (Japon)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europe)Sun type 7 USBSun type 7 USB (Europe)Sun type 7 USB (Japon)/Japonais 106 touchesSun type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Intervertir Ctrl et Verr. maj.Intervertir Échap. et Verr. maj.Échange Alt. gauche et Ctrl gaucheÉchange Win gauche et Ctrl gaucheÉchange Win droite et Ctrl droiteÉchangé avec les crochetsSuédoisSuédois (Dvorak A5)Suédois (Dvorak)Suédois (Macintosh)Suédois (Sun type 6/7)Suédois (Svdvorak)Suédois (US, avec lettres suédoises)Suédois (basé sur le Dvorak US internat.)Suédois (sans touche morte)Langue des signes suédoisePassage à une autre dispositionSymplon PaceBook (tablette)SyriaqueSyriaque (phonétique)TaïwanaisTaïwanais (indigène)TadjikTadjik (obsolète)Tamoul (Inscript)Tamoul (Sri Lanka, TamilNet '99)Tamoul (Sri Lanka, TamilNet '99, codage TAB)Tamoul (TamilNet '99 avec chiffres tamouls)Tamoul (TamilNet '99)Tamoul (TamilNet '99, codage TAB)Tamoul (TamilNet '99, codage TSCII)Targa Visionary 811TatarTélougouTélougou (phonétique KaGaPa)Télougou (Sarala)ThaïThaï (Pattachote)Thaï (TIS-820.2538)TibétainTibétain (avec chiffres ASCII)Vers la touche correspondante sur une disposition Dvorak.Vers la touche correspondante sur une disposition Dvorak.Vers la touche correspondante sur une disposition Qwerty.Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (touches Alt larges)Truly Ergonomic Computer Keyboard Model 229 (touches Alt de taille standard, touches Super et Menu)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Allemagne)Turc (Sun type 6/7)Turc (internat., avec touches mortes)Turc (touches mortes Sun)TurkmèneTurkmène (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)OudmourteOugaritique à la place de l'arabeUkrainienUkrainien (Sun type 6/7)Ukrainien (touches Windows)Ukrainien (homophonique)Ukrainien (obsolète)Ukrainien (phonétique)Ukrainien (RSTU standard)Ukrainien (machine à écrire)Ajouts Unicode (opérateurs mathématiques et flèches)Ajouts Unicode (opérateurs mathématiques et flèches ; opérateurs mathématiques au niveau par défaut)Unitek KB-1925Ourdou (Pakistan)Ourdou (Pakistan, CRULP)Ourdou (Pakistan, NLA)Ourdou (touches Windows)Ourdou (variante phonétique)Ourdou (phonétique)Utiliser les voyants du clavier pour indiquer une disposition alternativeUtiliser la barre d'espacement pour insérer une espace insécableL'espace habituelle quel que soit le niveauOuïghourOuzbekOuzbek (Afghanistan)Ouzbek (Afghanistan, OLPC)Ouzbek (latin)VietnamienVietnamien (AÐERTY)Vietnamien (français, avec lettres vietnamiennes)Vietnamien (QĐERTY)Vietnamien (US, avec lettres vietnamiennes)ViewSonic KU-306 InternetWang 724 avec ajouts Unicode (opérateurs mathématiques et flèches)Wang 724 avec ajouts Unicode (opérateurs mathématiques et flèches ; opérateurs mathématiques au niveau par défaut)La touche Windows est placé sur Impr. écr. (en plus de la touche Windows)Windows+EspaceWinbook Model XP5WolofYahoo! InternetIakuteYorubaAntiliant sans chasse au niveau 2Antiliant sans chasse au niveau 2. espace insécable au niveau 3Antiliant sans chasse au niveau 2, espace insécable au niveau 3, rien au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, espace fine insécable au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, liant sans chasse au niveau 4Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3, espace insécable au niveau 4Antiliant sans chasse au niveau 3, liant sans chasse au niveau 4akamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 (portable)eeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh@ 1.1 log @Initial revision @ text @@ 1.1.1.1 log @initial import of xkeyboard-config-2.27 @ text @@ 1.1.1.2 log @initial import of xkeyboard-config-2.29 @ text @d1 51 a51 51 4%/LJc c&cqEc_c!d9dPdgd}ddd d ddd-d*e-Ie$weee e ee e%e$"f%GfmffffffCf"g&g)>g&hgg gg g gggggghh4hJhF`h hhhhhhii +i9iKi[iqiiiWiYiYjbj{jjjjj4j k'k6kEkLkTk \khkkkk k kk k k k+k 'lT1llll"llllm/m @@m KmVmim}mmmmmm"mn/n LnYnjn{nn(nn,n#$o#Holoo#o"ooop"p5p$Ip?np%pp$pq%q=qTq eqoq qqqqqqr 3r Tr urJr>rE s&Osvssss9s.t@@3t@@ttGtTt"Ruuu~uuuuuuv3vDvTvdvtv |vvvv v vvvvww8wQw hwtw|wwwwwx%x$6x![x}x+x-x xy yy$y3y"Mypy"yy yy y zz;zXz`zgzwz zzzzz{ {{9{N{f{ { {{{{{{{{ ||8|L|*U|#| |||||}$}A:};|}.}(}~"~1~B~'_~~~~~~ &:Xr )&%Ag# ր 3"@@V#(́%54Q ˂3%7$Ot. Ń σ ك$$!I(k%ׄ &B JXi}'؅%2Xu"|$+Ԇ23CUe})χ߇-B"b"( ш߈ = R`|!#Љ)4Pa~NJ&8I[ d‹܋ $( M[z  ˌڌ(="]"( *DX0n Ȏ%:L[dm  ďˏ ";&[""Bb  ˑ֑ &)$E'j&)$'&0)W$'&Γ)$'DlĔՔ 6 Wat'"7M mw}ǖ"ޖ3 JXasї%& 4NUnv ˜!ؘ.@@QX`elؙ;Miʚޚ%7#;_ gs(țܛ"0Ebs)-85!n 4 D bmve7-4DZ ny.՟(-CL\ v #ؠ!( G+h%̡'7G\l%) ۢ 0; U _4m& ɣ"% %3"Y&|ڤau )ȥ((#Lev|æҦ)צ*E[x  ֧&"8)["#Ԩ  &9IZq &ש*#=Y$v# ˪ ת ##3=WM#M^Uͬ% # 9CWj#ҭS&H&o1  !%GZnͯӯ ۯ!;L,\4ݰ5E `k(,ı! !/Qf$}*$Ͳ :Zr ׳f!~% ƴѴ  '1fK ε.Mi } ʶ"!(J!^"#Ƿ޷(" 9ZkҸ!*?\+z ȹ ڹ $ 9 ESl"t&޺ @@0Q$9ӻ &=Ff"m*ռ#  ;&El,! $*&O,vξ 7*bȿ޿ *4_u7QYm~""/Kcj |-(:"O$r ,2+_+;d3 &Fck{.*(/ JTm-N o~&++Bn ,(2[Buc( EOagw}&Keu]oJCoJILOSX^cfjnqtx{~ !$'.147:=@@CFIMPSVY\_behknqtwz}6|'b)1$H'm$'  -51 g/,  &0B2R(2 W2D$1G&n ' +#OUl\ 3DW i w _cP  1I3a &(1 H R^ g q |+]&.6"Eh  "(=Uj${$ )D/b#."&/ J)T&~%/+P[9&&,Sj{$ 6!K m LLZ3'$M+Dy[XVsN'AJ]#v  .>N Varz #? Z fr' !1#Sw@@I, CMVh1.! 2%Kq$#%)?X'u" , 9F[ry !/6M *P Kq61&8G$X/}&0Wk66 m#.+5 CPn 7A,@@m1-!A^n  F'9'Qy-   !?$H!m(%1Jf n|&> %L#r7> !9-L4zA,G.e* H%i&(BJ(_'(12*!] &&6]&q !&>Gcw&'#+:'Ow -$J%o &&2 $E:b"&? R `kt $ $:#S'w"?_   ,/A*q-,/*' -R , / * - ,6 /c * -    (/ X i }         ? ] |  / '  "   $  , 6 P X j ~ %  (  )2DWg|%&#.*Ya~+!!2DU\di$q (BRl6':b it("-A_&p26 0;AQ( G?W]t m\|  :D`q/) $$>c #!* +67b''<L%k+   <F7Y</,4+1`-4 !5Wgw "/7g5o/%*9Ra$f'#( 4 !G i {   ' " )!C!\!"n!"!!!!!!!!" &"4" H" V"*d""1"%"# #&?#"f# # # # ## ###/$AJ$$A$Q$>%V%*n%%% %%%%)&:&T&q& &l&('(1'7Z'L'''' '((("(B(U(o(((((((( (%),)5)P)c)/u)?)') *%*7*)O*y*%* ***(*,+D+!`+&+++(+)+#&,J,`,y,,,, ,,-,- B-M-#c-j---3 . T.`.w.. ...m.R/Z/&n////&//0/0?0E0 c0o000$001#1$91$^111.1112,2J2g2{222$22%383T3r3 33 33333 4 4*4D4"J4)m44 4444 5<5Z5Dl55;5666 46>6^6(f666:6616/7)G7q7%z7777727$%8#J82n8.8/899-9 H9i99U99#:>:Q:h:~::::+::;);9;L;!k;#;";";;<<1<C<X<p<&<+<<< =1=M=V= m=x==== =,=+ >5>!K>#m>>> >>>>>? ??9??9y?9??@@@@@@-@@cn@@@@@@@@ AA A%A.A?A%SAyA AAAAA.B*1B \B"fB BBBBBBC)C7HCkCCC D&D=DVDtD8DBDBE+HE tE~EEEE EE2EF+,FXFErFyFK2G~GGGGGG!G@@GR&HdyH_H@@>I_I@@I J#J&J*J/J5J:J=JAJEJHJKJOJRJUJXJ\J_JbJeJiJlJpJsJvJyJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJK K KKKKKKK!K$K(K+K.K1K4K7K:K=K@@KCKFKIKLKOKRKUKXK_KbKeKhKkKnKqKtKwKzK~KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKW 3}#(>l WF5wM+"TmNY`r rX0;|n(n^w32 I {6ts5V_Z=D$UK 5IFG"&Ko%&Lt9*/17wG,U`W3Vu7[X51]8_`|\9c&<ejgP&W64>ly4mDqr@@u0xwc18vY/,p$6n} FNMkzBLC+o.K(MS`"tD]Cvh[x #~f}*ZdiyYqXX-<N $>cHJb|Lxj3j!S[uh)g ,*Fj7oxn;g %GjaC rVRuz^PAqTVD%E m!PMYe\JzC|V]dHF^!]pg9:O/cLNde; A2(UB:*Qkii;:'L$f1a0!t Ems=)[MND< 8%EY6O{Jxk\ ZsTU@@\I2vdUK `'_=8QO(rEk.wk*gba" i?S<{v'+[^y2hH;J f )&?X>e,5\KuoAAy._ B)b!+@@?|O%B pt#qfPQ9-RR^nGHI@@ i]{qS a~+8C:WEA,?Q$IH@@"97<f4)l/-?d>4b'lZO~G{sm.s .'p_paRc0}2-1S}Qzeh:P~BJol7 ~v-0T RZ =#/Ty3#z =4hb6<Less/Greater><Less/Greater> chooses 5th level<Less/Greater> chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser<Less/Greater>; acts as onetime lock when pressed together with another 3rd level chooser3rd level of <Less/Greater>3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Albanian (Veqilharxhi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as Control, Control as HyperCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (alt.)Cherry CyBo@@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqComposeCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with <\|> key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (3l)English (3l, chromebook)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Drix)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)EurKEY (US based layout with European letters)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Dvorak)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AFNOR standardized AZERTY)French (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, AFNOR)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (US, AZERTY)French (US, with French letters)French (US, with French letters, with dead keys, alternative)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGerman, Swedish and Finnish (US)GreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianIndonesian (Arab Melayu, ext. phonetic)Indonesian (Arab Melayu, phonetic)Indonesian (Javanese)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMake unmodified Caps Lock an additional Esc, but Shift + Caps Lock behaves like regular Caps LockMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (UK layout with AltGr overrides)Maltese (US layout with AltGr overrides)Maltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian GalikMongolian ManchuMongolian Manchu GalikMongolian TodoMongolian Todo GalikMongolian XibeMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (British keyboard)Polish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic Macintosh)Russian (phonetic yazherty)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamogitianSamsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (ACC layout, only accented letters)Slovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+<key>) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to indicate modifiersUse keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French, with Vietnamese letters)Vietnamese (QĐERTY)Vietnamese (US, with Vietnamese letters)ViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjajvkakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.28.99 d53 2 a54 1 PO-Revision-Date: 2020-01-26 18:21+0100 d63 1 a63 1 <Plus petit/Plus grand><Plus petit/Plus grand> sélectionne le niveau 5<Plus petit/Plus grand> sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveau<Plus petit/Plus grand>, avec un autre sélecteur de niveau 3, enclenche une fois ce niveauNiveau 3 de <Plus petit/Plus grand>Niveau 3 de Verr. Maj.Niveau 3 de la touche Ctrl de gaucheNiveau 3 de la touche Windows de gaucheNiveau 3 de menuNiveau 3 de la touche Ctrl de droiteNiveau 3 de la touche Windows de droiteA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSymboles clavier APL : disposition APL unifiée APLXSymboles clavier APL : IBM APL2Symboles clavier APL : Manugistics APL*PLUS IISymboles clavier APL : disposition unifiéeSymboles APL : saxClavier de type téléphoniqueAcer AirKey VAcer C300Acer Ferrari 4000Acer (portable)Ajouter du comportement standard à la touche MenuAjout des lettres accentuées EspérantoAjout des signes monétaires sur certaines touchesAdvance Scorpius KIAfghanAkanAlbanaisAlbanais (Plisi)Albanais (Veqilharxhi)Autorise des actions clavier à casser les captures (attention : faille de sécurité)Autorise l'enregistrement des captures et arborescences de fenêtresAlt et Meta sont sur les touches AltAlt est placé sur Windows droite, Super sur MenuAlt est placé sur les touches Windows (et les touches Alt habituelles)Alt échangé avec WindowsAlt+Verr. maj.Alt+CtrlAlt+Maj.Alt+EspaceComportement des touches Alt et WindowsAmhariqueN'importe quelle touche AltN'importe quelle touche WindowsN'importe quelle touche Windows (maintenue)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium : émulation des touches PC (Impr. écr. ; défil. ; pause ; Verr. Num.)Apple (portable)ArabeArabe (azerty)Arabe (azerty/chiffres)Arabe (Algérie)Arabe (Buckwalter)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (qwerty)Arabe (Sun type 6/7)Arabe (Syrie)Arabe (chiffres)Arabe (qwerty/chiffres)Arabe (avec extensions pour l'écriture arabe d'autres langues et chiffres arabes en priorité)Arabe (avec extensions pour l'écriture arabe d'autres langues et chiffres européens en priorité)ArménienArménien (phonétique OLPC)Arménien (variante orientale)Arménien (variante phonétique)Arménien (orientale)Arménien (phonétique)Arménien (occidentale)Asturien (Espagne, avec H point bas et L point bas)Asus (portable)En bas à gaucheÀ gauche du « A »AtsinaAvatimeAvestiqueAzériAzéri (cyrillique)Azona RF2300 clavier internet sans filBTC 5090BTC 5113RF multimédiaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarre oblique inverseLa barre oblique inverse, avec un autre sélecteur de niveau 3, enclenche une fois ce niveauBambaraBengaliBengali (Inde)Bengali (Inde, Inscript Baishakhi)Bengali (Inde, Baishakhi)Bengali (Inde, Bornona)Bengali (Inde, Probhat)Bengali (Inde, Uni Gitanjali)Bengali (Probhat)BachkirBiélorusseBiélorusse (latin)Biélorusse (obsolète)BelgeBelge (Sun type 6/7)Belge (Wang 724 azerty)Belge (variante ISO)Belge (variante)Belge (variante, Latin-9 uniquement)Belge (variante, touches mortes Sun)Belge (sans touche morte)Belge (touches mortes Sun)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbère (Algérie, latin)Berbère (Algérie, Tifinagh)Berbère (Maroc, Tifinagh variante phonétique)Berbère (Maroc, variante Tifinagh)Berbère (Maroc, Tifinagh étendu phonétique)Berbère (Maroc, Tifinagh étendu)Berbère (Maroc, Tifinagh phonétique)Berbère (Maroc, Tifinagh)BosniaqueBosniaque (US, avec digraphes bosniaques)Bosniaque (US avec lettres bosniaques)Bosniaque (avec digraphes bosniaques)Bosniaque (avec guillemets)Les deux Alt ensembleLes deux Ctrl ensembleLes deux Maj. ensembleLes 2 touches Maj. ensemble activent Verr. maj.Les 2 touches Maj. ensemble activent le Verr. maj., la touche Maj. le désactiveLes 2 touches Maj. ensemble activent le blocage majusculeBrailleBraille (pour gaucher, pouce inversé)Braille (pour gaucher)Braille (pour droiter, pouce inversé)Braille (pour droiter)Brother InternetBulgareBulgare (nouvelle phonétique)Bulgare (phonétique traditionnelle)BirmanBirman ZawgyiCameroun multilingue (azerty)Cameroun multilingue (Dvorak)Cameroun multilingue (qwerty)Canadien multilingueCanadien multilingue (1re partie)Canadien multilingue (2e partie)Verr. maj.Verr. maj. (maintenu), Alt + Verr. maj. joue le rôle original de Verr. maj.Verr. maj. agit comme un verrouillage de maj ; Maj. l'annule temporairementVerr. maj. agit comme Maj. quand il est verrouillé ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj. comme Ctrl, Ctrl comme HyperVerr. maj. comme CtrlComportement de la touche Verr. maj.Verr. maj. est également CtrlVerr. maj. est désactivéVerr. maj. (première disposition), Maj. + Verr. maj. (dernière disposition)Verr. maj. bascule le blocage majuscule (affecte toutes les touches)Verr. maj. active ou désactive la mise en majuscule usuelle des caractères alphabétiquesVerr. maj. utilise la mise en majuscule interne ; Maj. annule temporairement Verr. maj.Verr. maj. utilise la mise en majuscule interne ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj., avec un autre sélecteur de niveau 3, enclenche une fois ce niveauCatalan (Espagne, avec L point médian)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (variante)Cherry CyBo@@rd concentrateur USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony internetChicony KB-9885Chicony KU-0108Chicony KU-0108ChinoisChromebookLiturgique slaveChuvashTchouvache (latin)Classmate PCCló GaelachSalish Cœur d'AlèneCompaq Armada (portable)Compaq Easy AccessCompaq Internet (13 touches)Compaq Internet (18 touches)Compaq Internet (7 touches)Compaq Presario (portable)Compaq iPaqCompositionCreative Desktop Wireless 7000Tatar de Crimée (Q dobroudja)Tatar de Crimée (Alt-Q turc)Tatar de Crimée (F turc)Tatar de Crimée (Q turc)CroateCroate (US, avec les digraphes croates)Croate (US, avec lettres croates)Croate (avec les digraphes croates)Croate (avec guillemets)Ctrl est placé sur les touches Alt, Alt sur les touches WindowsCtrl est placé sur les touches Windows (et les touches Ctrl habituelles)Position de CtrlCtrl+Alt+Eff. arrièreCtrl+Maj.TchèqueTchèque (qwerty)Tchèque (qwerty, Macintosh)Tchèque (qwerty, barre oblique inverse étendue)Tchèque (Sun type 6/7)Tchèque (UCW, lettres accentuées uniquement)Tchèque (Dvorak US, support UCW)Tchèque (codage)Tchèque (programmation)Tchèque (programmation, typographie)Tchèque (typographie)Tchèque (avec la touche <\|>)Tchèque, slovaque et allemand (US)DTK2000DanoisDanois (Dvorak)Danois (Macintosh)Danois (Macintosh, sans touche morte)Danois (Sun type 6/7)Danois (Touches Windows)Espagnol (sans touche morte)Touches du pavé numérique par défautDellDell PC 101 touchesDell Inspiron 6000/8000 (portable)Dell Latitude (portable)Dell Precision M (portable)Dell Precision M65 (portable)Dell SK-8125Dell SK-8135Dell USB MultimédiaDexxa Wireless DesktopDivehiDiamond 9801/9802NéerlandaisNéerlandais (Macintosh)Danois (Sun type 6/7)Néerlandais (standard)Néerlandais (touches mortes Sun)Dyalog APL completDzongkhaDalécarlien (Suède, avec ogonek combinatoire)Active des caractères typographiques supplémentairesAnglais (3l)Anglais (3l, chromebook)Anglais (Australien)Anglais (Cameroun)Anglais (Canada)Anglais (Carpalx)Anglais (Carpalx, complètement optimisé)Anglais (Carpalx, complètement optimisé, internat., touches mortes via AltGr)Anglais (Carpalx, complètement optimisé, internat., avec touches mortes)Anglais (Carpalx, internat., touches mortes via AltGr)Anglais (Carpalx, internat., avec touches mortes)Anglais (Colemak)Anglais (Drix)Anglais (Dvorak)Anglais (Dvorak, variante internat.)Anglais (Dvorak, internat. avec touches mortes)Anglais (Dvorak, pour gaucher)Anglais (Dvorak pour droitier)Anglais (Ghana)Anglais (Ghana, GILLBT)Anglais (Ghana, multilingue)Anglais (Inde, avec le symbole Roupie)Anglais (Macintosh)Anglais (Mali, US, Macintosh)Anglais (Mali, US, internat.)Anglais (Nigeria)Anglais (Norman)Anglais (Afrique du Sud)Anglais (Royaume-Uni)Anglais (Royaume-Uni, Colemak)Anglais (Royaume-Uni, Dvorak)Anglais (Royaume-Uni, Dvorak, ponctuation britannique)Anglais (Royaume-Uni, Macintosh)Anglais (Royaume-Uni, Sun type 6/7)Anglais (Royaume-Uni, étendu, touche Windows)Anglais (Royaume-Uni, internat., Macintosh)Anglais (Royaume-Uni, internat., avec touches mortes)Anglais (US)Anglais (US, Arabe IBM 238_L)Anglais (US, Sun type 6/7)Anglais (US, variante internat.)Anglais (US, Euro sur le 5)Anglais (US, international, AltGr combinatoire Unicode)Anglais (US, international, AltGr combinatoire Unicode, variante)Anglais (US, internat., avec touches mortes)Anglais (Workman)Anglais (Workman, internat., avec touches mortes)Anglais (Dvorak classique)Anglais (internat., touches mortes via AltGr)Anglais (Dvorak pour programmeur)Anglais (les touches diviser/multiplier basculent la disposition)Ennyah DKB-1008Entrée sur le pavé numériqueEspérantoEspéranto (Brésil, Nativo)Espéranto (Portugal, PT-Nativo)Espéranto (point-virgule et guillemets simples déplacés, obsolète)EstonienEstonien (Dvorak)Estonien (Sun type 6/7)Estonien (US, avec lettres estoniennes)Estonien (sans touche morte)EurKEY (clavier US avec lettres européennes)Euro sur le 2Euro sur le 4Euro sur le 5Euro sur le EEverex STEPnoteÉwéFL90FéroïenFéroïen (sans touche morte)FilipinoFilipino (Capewell-Dvorak, baybayin)Filipino (Capewell-Dvorak, latin)Filipino (Capewell-QWERF 2006, baybayin)Filipino (Capewell-QWERF 2006, latin)Filipino (Colemak, baybayin)Filipino (Colemak, latin)Filipino (Dvorak, baybayin)Filipino (Dvorak, latin)Filipino (qwerty, baybayin)FinnoisFinnois (DAS)Finnois (Dvorak)Finnois (Macintosh)Finnois (Sun type 6/7)Finnois (Touches Windows)Finnois (classique)Finnois (classique, sans touche morte)Touche à quatre niveaux avec le séparateur décimal abstraitTouche à quatre niveaux avec virguleTouche à quatre niveaux avec pointTouche à quatre niveaux avec point, Latin-9 uniquementTouche à quatre niveaux avec le séparateur décimal momayyezFrançaisFrançais (azerty standard AFNOR)Français (azerty)Français (Bépo, ergonomique, façon Dvorak)Français (Bépo, ergonomique, façon Dvorak, AFNOR)Français (Bépo, ergonomique, façon Dvorak, Latin-9 uniquement)Français (breton)Français (Cameroun)Français (Canada)Français (Canada, Dvorak)Français (Canada, obsolète)Français (République démocratique du Congo)Français (Dvorak)Français (Guinée)Français (Macintosh)Français (Mali, variante)Français (Maroc)Français (Sun type 6/7)Français (Suisse)Français (Suisse, Macintosh)Français (Suisse, Sun type 6/7)Français (Suisse, sans touche morte)Français (Suisse, touches mortes Sun)Français (Togo)Français (US, azerty)Français (US, avec lettres françaises)Français (US, avec lettres françaises, touches mortes, variante)Français (variante)Français (variante, Latin-9 uniquement)Français (variante, sans touche morte)Français (variante, touches mortes Sun)Français (variante obsolète)Français (variante obsolète, sans touche morte)Français (variante obsolète, touches mortes Sun)Français (sans touche morte Sun)Français (touches mortes Sun)Frioulan (Italie)Fujitsu-Siemens Amilo (portable)PeulGaPC générique 101 touchesPC générique 102 touches (internat.)PC générique 104 touchesPC générique 105 touches (internat.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGéorgienGéorgien (France, azerty Tskapo)Géorgien (Italie)Géorgien (MESS)Géorgien (ergonomique)AllemandAllemand (Aus der Neo-Welt)Allemand (Autriche)Allemand (Autriche, Macintosh)Allemand (Autriche, sans touche morte)Allemand (Autriche, touches mortes Sun)Allemand (Bone)Allemand (Bone, ß et q échangés)Allemand (Dvorak)Allemand (KOY)Allemand (Macintosh)Allemand (Macintosh, sans touche morte)Allemand (Neo 2)Allemand (Neo qwerty)Allemand (Neo qwertz)Allemand (qwerty)Allemand (Sun type 6/7)Allemand (Suisse)Allemand (Suisse, Macintosh)Allemand (Suisse, Sun type 6/7)Allemand (Suisse, obsolète)Allemand (Suisse, sans touche morte)Allemand (Suisse, touches mortes Sun)Allemand (T3)Allemand (US, avec lettres allemandes)Allemand (accent aigu en touche morte)Allemand (accents aigu et grave en touches mortes)Allemand (tilde en touche morte)Allemand (sans touche morte)Allemand (avec les lettres hongroises, sans touche mortes)Allemand (touches mortes Sun)Allemand (Ladin)Allemand, suédois et finnois (US)GrecGrec (Colemak)Grec (Sun type 6/7)Grec (étendu)Grec (sans touche morte)Grec (polytonique)Grec (simple)GujarâtîGyrationHanyu Pinyin (altgr)Happy HackingHappy Hacking pour MacHaoussa (Ghana)Haoussa (Nigeria)HébreuHébreu (biblique, SIL, phonétique)Hébreu (biblique, Tiro)Hébreu (lyx)Hébreu (phonétique)Hewlett-Packard InternetHewlett-Packard Mini 110 (portable)Hewlett-Packard NEC SK-2500 MultimédiaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadécimalHindi (bolnagri)Hindi (phonétique KaGaPa)Hindi (Wx)Honeywell EuroboardHongroisHongrois (101/qwerty/virgule/touches mortes)Hongrois (101/qwerty/virgule/sans touche morte)Hongrois (101/qwerty/point/touches mortes)Hongrois (101/qwerty/point/sans touche morte)Hongrois (101/qwertz/virgule/touches mortes)Hongrois (101/qwertz/virgule/sans touche morte)Hongrois (101/qwertz/point/touches mortes)Hongrois (101/qwertz/point/sans touche morte)Hongrois (102/qwerty/virgule/touches mortes)Hongrois (102/qwerty/virgule/sans touche morte)Hongrois (102/qwerty/point/touches mortes)Hongrois (102/qwerty/point/sans touche morte)Hongrois (102/qwertz/virgule/touches mortes)Hongrois (102/qwertz/virgule/sans touche morte)Hongrois (102/qwertz/point/touches mortes)Hongrois (102/qwertz/point/sans touche morte)Hongrois (qwerty)Hongrois (sans touche morte)Hongrois (standard)Hyper est placé sur les touches WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandaisIslandais (Dvorak)Islandais (Macintosh)Islandais (Macintosh, obsolète)Islandais (sans touche morte)Islandais (touches mortes Sun)IgboIndienIndonésien (Arabe Malayu, phonétique étendu)Indonésien (Arabe Malayu, phonétique)Indonésien (Javanais)Alphabet phonétique internationalInuktitutIrakienIrlandaisIrlandais (UnicodeExpert)ItalienItalien (IBM 142)Italien (Macintosh)Italien (Sun type 6/7)Italien (US, avec lettres italiennes)Italien (touche Windows)Italien (internat., avec touches mortes)Italien (sans touche morte)Italien (Ladin)JaponaisJaponais (Dvorak)Japonais (Kana 86)Japonais (Kana)Japonais (Macintosh)Japonais (OADG 109A)Japonais (PC-98)Japonais (Sun type 6)Japonais (Sun type 7 - compatible PC)Japonais (Sun type 7 - compatible Sun)Options des claviers japonaisKalmykLa touche « verrouillage Kana » verrouilleKannadaKannada (phonétique KaGaPa)CachoubeKazakhKazakh (latin)Kazakh (étendu)Kazakh (avec russe)Séquence de touches pour tuer le serveur XTouche sélectionnant le niveau 5Touche sélectionnant le niveau 3Keytronic FlexProKhmer (Cambodge)KikuyuKinesisKomiCoréenCoréen (compatible 101/104 touches)Coréen (Sun type 6/7)Touches Hangeul/Hanja coréennesKurde (Iran, arabe-latin)Kurde (Iran, F)Kurde (Iran, Alt-Q latin)Kurde (Iran, Q latin)Kurde (Irak, arabe-latin)Kurde (Irak, F)Kurde (Irak, Alt-Q latin)Kurde (Irak, Q latin)Kurde (Syrie, F)Kurde (Syrie, Alt-Q latin)Kurde (Syrie, Q latin)Kurde (Turquie, F)Kurde (Turquie, Alt-Q latin)Kurde (Turquie, Q latin)KutenaiKirghizeKirghize (phonétique)LaoLao (disposition proposée par la STEA)LettonLetton (F)Letton (Sun type 6/7)Letton (Colemak US)Letton (Colemak US, variante apostrophe)Letton (Dvorak US)Letton (Dvorak US, variante Y)Letton (Dvorak US, variante moins)Letton (adapté)Letton (apostrophe)Letton (ergonomique, ŪGJRMV)Letton (moderne)Letton (Dvorak pour le programmeur US)Letton (Dvorak pour le programmeur US, variante Y)Letton (Dvorak pour le programmeur US, variante moins)Letton (tilde)Disposition du pavé numériqueAlt gaucheAlt gauche (maintenu)Alt. gauche pour Ctrl, Ctrl pour Win, Win gauche pour Alt. gaucheAlt gauche échangé avec Windows gaucheAlt gauche+Maj. gaucheCtrl gaucheCtrl gauche comme MétaCtrl gauche (première disposition), Ctrl droit (dernière disposition)Ctrl gauche+Maj. gaucheCtrl gauche + Windows gaucheCtrl gauche + Windows gauche (première disposition), Ctrl droit + Menu (seconde disposition)Maj. gaucheTouche Windows gaucheWindows gauche (maintenu)Windows gauche sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauTouche Windows gauche (première disposition), touche Windows droite (dernière disposition)ObsolèteWang 724 (clavier obsolète)Touche obsolète avec virguleTouche obsolète avec pointLituanienLituanien (IBM LST 1205-92)Lituanien (LEKP)Lituanien (LEKPa)Lituanien (Sun type 6/7)Lituanien (Dvorak US avec lettres lituaniennes)Lituanien (US, avec lettres lituaniennes)Lituanien (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (variante)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (variante 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTouches supplémentaires Logitech G15 via le démon G15Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bas-sorabeBas-sorabe (qwertz)MacBook/MacBook ProMacBook/MacBook Pro (Internat.)MacédonienMacédonien (sans touche morte)MacintoshMacintosh (ancien)Rester compatible avec les anciens code clavier SolarisFaire de Verr. maj. un Effacement. arrière supplémentaire.Faire de Verr. maj. un Échap. supplémentaire.Faire de Verr. maj. un Hyper supplémentaireFaire de Verr. maj. une touche Menu supplémentaire.Faire de Verr. maj. un Verr. Num. supplémentaireFaire de Verr. maj. un Super supplémentaire.Faire du Zenkaku Hankaku un Échap. supplémentaire.Alt. droite comme touche hangeulAlt. droite comme touche hanjaCtrl. droite comme touche hangeulCtrl. droite comme touche hanjaFaire de Verr. maj. un Échap. supplémentaire, mais Maj. + Verr. maj. a l'effet du Verr. maj. habituelMalais (clavier jawi, arabe)Malais (jawi, phonétique)MalayâlamMalayâlam (lalitha)Malayâlam (Inscript amélioré avec le roupie)MaltaisMaltais (disposition anglaise, débrayable via AltGr)Maltais (disposition US, débrayable via AltGr)Maltais (avec disposition US)Meitei (Eeyek)MaoriMarathi (phonétique KaGaPa)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (maintenu), Maj.+Menu pour MenuMenu comme Ctrl droiteMenu est placé sur les touches WindowsMéta est placé sur Windows gaucheMéta est placé sur les touches WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (suédois)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB /Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Clavier Microsoft OfficeMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0ADiverses options de compatibilitéM'mockMoldaveMoldave (Gagaouze)MongolMongol (bichig)Mongol (galik)Mongol (mandchou)Mongol (galik mandchou)Mongol (todo)Mongol (galik todo)Mongol (xibe)MonténégrinMonténégrin (cyrillique avec guillemets)Monténégrin (cyrillique)Monténégrin (cyrillique, ZE et ZHE intervertis)Monténégrin (latin avec guillemets)Monténégrin (latin, qwerty)Monténégrin (latin, Unicode)Monténégrin (latin, Unicode, qwerty)Multilingue (Canada, Sun type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Eff. Arr. du type NICOLA-FNépalaisEspace insécable au niveau 2Espace insécable au niveau 3Espace insécable au niveau 3, rien au niveau 4Espace insécable au niveau 3, espace fine insécable au niveau 4Espace insécable au niveau 4Espace insécable au niveau 4, espace fine insécable au niveau 6Espace insécable au niveau 4, espace fine insécable au niveau 6 (via Ctrl+Maj.)Sami du Nord (Finlande)Sami du Nord (Norvège)Sami du Nord (Norvège, sans touche morte)Sami du Nord (Suède)Northgate OmniKey 101NorvégienNorvégien (Colemak)Norvégien (Dvorak)Norvégien (Macintosh)Norvégien (Macintosh, sans touche morte)Norvégien (Sun type 6/7)Norvégien (Touches Windows)Norvégien (sans touche morte)Verr. Num.Verr. num. activé : chiffres ; maj. pour les flèches. Verr. num. désactivé : flèches (comme Windows)Touche numérique 4 pour un appui isoléTouche numérique 9 pour un appui isoléComportement de la touche de Suppr. du pavé numériqueLes touches du pavé numérique sont toujours numériques (comme sur Mac OS)OLPCOccitanOghamOgham (IS434)SantaliRunes HongroisesOriyaOrtek MCK-800 Multimédia/InternetOssète (Géorgie)Ossète (touches Windows)Ossète (obsolète)PC-98Ruthène pannonienPosition des parenthèsesPachtoPachto (Afghanistan, OLPC)PausePersanPersan (Afghanistan, Dari, OLPC)Persan (avec pavé numérique persan)PolonaisPolonais (clavier anglais)Polonais (Colemak)Polonais (Dvorak)Polonais (Dvorak, guillemets polonais sur le 1)Polonais (Dvorak, guillemets polonais sur la touche guillemets)Polonais (Allemagne, sans touche morte)Polonais (glagolitique)Polonais (qwertz)Polonais (Sun type 6/7)Polonais (internat., avec touches mortes)Polonais (obsolète)Polonais (Dvorak pour le programmeur)PortugaisPortugais (Brésil)Portugais (Brésil, Dvorak)Portugais (Brésil, ThinkPad IBM/Lenovo)Portugais (Brésil, Nativo pour claviers US)Portugais (Brésil, Nativo)Portugais (Brésil, Sun type 6/7)Portugais (Brésil, sans touche morte)Portugais (Colemak)Portugais (Macintosh)Portugais (Macintosh, sans touche morte)Portugais (Macintosh, touches mortes Sun)Portugais (Nativo pour claviers US)Portugais (PT-Nativo)Portugais (Sun type 6/7)Portugais (sans touche morte)Portugais (touches mortes Sun)Position de la touche ComposePropeller Voyager KTEZ-1000Impr. Écr.Penjabi (Gurmukhî, Jhelum)Penjabi (Gurmukhî)QTronix Scorpius 98N+Alt droiteAlt droite (maintenu)Alt droite sélectionne le niveau 5Alt. droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauAlt droite ne sélectionne jamais le niveau 3Alt droite, Maj. + Alt droite est la touche composeCtrl droiteCtrl droite (maintenu)Ctrl droite comme Alt droiteCtrl droite + Maj. droiteMaj. droiteWindows droiteWindows droite (maintenu)Windows droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, enclenche une fois ce niveauRoumainRoumain (Allemagne)Roumain (Allemagne, sans touche morte)Roumain (Sun type 6/7)Roumain (touche Windows)Roumain (cédille)Roumain (ergonomique dactylographique)Roumain (standard, cédille)Roumain (standard)Roupie sur le 4RusseRusse (Tchèque, phonétique)Russe (DOS)Russe (Géorgie)Russe (Allemagne, phonétique)Russe (Allemagne, recommandé)Russe (Allemagne, translittération)Russe (Kazakhstan, avec kazakh)Russe (Macintosh)Russe (Pologne, Dvorak phonétique)Russe (polyglotte et réactionnaire)Russe (Rulemak, Colemak phonétique)Russe (Sun type 6/7)Russe (Suède, phonétique)Russe (Suède, phonétique, sans touche morte)Russe (US, phonétique)Russe (Ukraine, RSTU standard)Russe (obsolète)Russe (Macintosh phonétique)Russe (phonétique yazherty)Russe (phonétique)Russe (phonétique, azerty)Russe (phonétique, Dvorak)Russe (phonétique, français)Russe (phonétique, touches Windows)Russe (machine à écrire)Russe (machine à écrire, obsolète)Russe (avec ponctuation US)Russe (Ukrainien-Biélorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taïwan)SamogitienSamsung SDM 4500PSamsung SDM 4510PSanscrit (phonétique KaGaPa)Sanwa Supply SKB-KG3Arrêt défilementSecwepemctsinPoint-virgule au niveau 3SerbeSerbe (cyrillique avec guillemets)Serbe (cyrillique, ZE et ZHE intervertis)Serbe (Latin avec guillemets)Serbe (Latin)Serbe (Latin, qwerty)Serbe (latin, Unicode)Serbe (latin, Unicode, qwerty)Serbe (Russe)Serbe (accents combinatoires à la place des touches mortes)Serbo-Croate (US)Maj. + VerrNum bascule le contrôle souris au clavier (PointerKeys) Maj. annule Verr. maj.Maj. n'annule pas Verr. num., mais sélectionne le niveau 3Maj.+ Verr. maj.SicilienSicilien (clavier US)SilésienSilvercrest Multimedia WirelessSindhîCingalais (US, avec lettres cingalaises)Cingalais (phonétique)SlovaqueSlovaque (disposition ACC, lettres accentuées uniquement)Slovaque (qwerty)Slovaque (qwerty, barre oblique inverse étendue)Slovaque (Sun type 6/7)Slovaque (barre oblique inverse étendue)SlovèneSlovène (US, avec lettres slovènes)Slovène (avec guillemets)EspagnolEspagnol (Dvorak)Espagnol (Amérique latine)Espagnol (Amérique latine, Colemak spécial jeux)Espagnol (Amérique latine, Colemak)Espagnol (Amérique latine, Dvorak)Espagnol (Amérique latine, tilde en touche morte)Espagnol (Amérique latine, sans touche morte)Espagnol (Amérique latine, touches mortes Sun)Espagnol (Macintosh)Espagnol (Sun type 6/7)Espagnol (touches Windows)Espagnol (tilde en touche morte)Espagnol (sans touche morte)Espagnol (touches mortes Sun)Les combinaisons spéciales (Ctrl+Alt+<touche>) sont traitées par le serveur XSteelSeries Apex 300 (Apex RAW)Compatibilité avec les touches SunSun type 6 (Japon)Sun type 6 USB (Japon)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europe)Sun type 7 USBSun type 7 USB (Europe)Sun type 7 USB (Japon)/Japonais 106 touchesSun type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Intervertir Ctrl et Verr. maj.Intervertir Échap. et Verr. maj.Échange Alt. gauche et Ctrl gaucheÉchange Win gauche et Ctrl gaucheÉchange Win droite et Ctrl droiteÉchangé avec les crochetsSuédoisSuédois (Dvorak A5)Suédois (Dvorak)Suédois (Macintosh)Suédois (Sun type 6/7)Suédois (Svdvorak)Suédois (US, avec lettres suédoises)Suédois (basé sur le Dvorak US internat.)Suédois (sans touche morte)Langue des signes suédoisePassage à une autre dispositionSymplon PaceBook (tablette)SyriaqueSyriaque (phonétique)TaïwanaisTaïwanais (indigène)TadjikTadjik (obsolète)Tamoul (Inscript)Tamoul (Sri Lanka, TamilNet '99)Tamoul (Sri Lanka, TamilNet '99, codage TAB)Tamoul (TamilNet '99 avec chiffres tamouls)Tamoul (TamilNet '99)Tamoul (TamilNet '99, codage TAB)Tamoul (TamilNet '99, codage TSCII)Targa Visionary 811TatarTélougouTélougou (phonétique KaGaPa)Télougou (Sarala)ThaïThaï (Pattachote)Thaï (TIS-820.2538)TibétainTibétain (avec chiffres ASCII)Vers la touche correspondante sur une disposition Dvorak.Vers la touche correspondante sur une disposition Dvorak.Vers la touche correspondante sur une disposition Qwerty.Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (touches Alt larges)Truly Ergonomic Computer Keyboard Model 229 (touches Alt de taille standard, touches Super et Menu)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Allemagne)Turc (Sun type 6/7)Turc (internat., avec touches mortes)Turc (touches mortes Sun)TurkmèneTurkmène (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)OudmourteOugaritique à la place de l'arabeUkrainienUkrainien (Sun type 6/7)Ukrainien (touches Windows)Ukrainien (homophonique)Ukrainien (obsolète)Ukrainien (phonétique)Ukrainien (RSTU standard)Ukrainien (machine à écrire)Ajouts Unicode (opérateurs mathématiques et flèches)Ajouts Unicode (opérateurs mathématiques et flèches ; opérateurs mathématiques au niveau par défaut)Unitek KB-1925Ourdou (Pakistan)Ourdou (Pakistan, CRULP)Ourdou (Pakistan, NLA)Ourdou (touches Windows)Ourdou (variante phonétique)Ourdou (phonétique)Utiliser les LED clavier pour indiquer les modificateursUtiliser les LED clavier pour indiquer une disposition alternativeUtiliser la barre d'espacement pour insérer une espace insécableL'espace habituelle quel que soit le niveauOuïghourOuzbekOuzbek (Afghanistan)Ouzbek (Afghanistan, OLPC)Ouzbek (latin)VietnamienVietnamien (AÐERTY)Vietnamien (français, avec lettres vietnamiennes)Vietnamien (QĐERTY)Vietnamien (US, avec lettres vietnamiennes)ViewSonic KU-306 InternetWang 724 avec ajouts Unicode (opérateurs mathématiques et flèches)Wang 724 avec ajouts Unicode (opérateurs mathématiques et flèches ; opérateurs mathématiques au niveau par défaut)La touche Windows est placé sur Impr. écr. (en plus de la touche Windows)Windows+EspaceWinbook Model XP5WolofYahoo! InternetIakuteYorubaAntiliant sans chasse au niveau 2Antiliant sans chasse au niveau 2. espace insécable au niveau 3Antiliant sans chasse au niveau 2, espace insécable au niveau 3, rien au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, espace fine insécable au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, liant sans chasse au niveau 4Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3, espace insécable au niveau 4Antiliant sans chasse au niveau 3, liant sans chasse au niveau 4akamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 (portable)eeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjajvkakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh@ 1.1.1.3 log @initial import of xkeyboard-config-2.31 @ text @d1 51 a51 61 %I|Kdddddde &e Ge Teaeeeee%e%ef 2f @@fJf \f%hfffffffCf"$gGg_g)tg&gg gg g ghhh h8h>hUhkh2h hhh(hi5iHi \i=}iii iii(j8jNj]jfjjjjjj)j k!k,4k+ak+kkkk kkkll 1l ;lGl Pl Zl el+ol lTllm m"m;mUmmmmm m mmmmnnn9nPnhnnnn nnnn,o#Bo#fo)ooo o#op(pBpTpgp${p?p%pq$q3q%Iqoqq qqq qqqr r%9r_rprr rJr>rE:ss ssss9s//t@@_t@@tGtT)u"~uuuuuu v$vAv_vpvvvv vvvv v vvww0wJwdw}w wwwwwwwx6xPx Yx%gx!xx!x(x y#y 6yAyPyVyey"yy"yy yz z=zQzmzzzzz zzz{{6{;{K{j{{{ { {{{{{||(|=|S|d|*m||#| ||}})}<}M}$_}A};}.~(1~Z~l~{~~'~~~6Tp ).Xp#ʀ 5Le,}2#݁(<%U{/ǂׂ  )#<`i{  Ń σ ك %$.!S(u%Ą0L Tbs…' $%<b І6)NxЇ"2#U"y ˈ׈ 2N$d#Éԉ *2]p&؊ %6F[b|ɋ % , 8 DQ` s͌݌ "?#b" ƍ ҍލ  -6 d֎# -; Q_ox ď֏&6S"s֐3 JVg  -0+.G-v0+Ւ.-00^+.-0+I.uҔ> [ |͕+ "8[q Ŗז 1QhqЗ$%B\&y(+ɘ+!(AI dnu!Ι%,49@@`vښ!=UhЛ ""4Wh Ӝ#2'V~8ɝ!$ 8B4TD  `#7ßӟ 9K^x Ѡ #3!W(y +á%'=Y'jǢ%) 6D[o  &ȣ P"a%%"Ф&6Qn ɥ)ݥ"(2 [hyǦ֦)ۦ.I_| § ڧ&"<)_"بߨ  0B[n *ʩ'9$V${# Ī Ъ ܪ  ##8=\M#M ^ZҬ%)A Wau#­ۭK&]&1ʮ  &4"R u!ί -3 ;\z,а42Qdt Ա߱(,8e!!Ųڲ%$$<auijܳ+ AKea!% +6Qi a .Ogzȶ ܶ );W"v!!Ϸ"#8O(j ˸ܸ 'B]yȹ+ &4 FQcu ٺ&#,<T m 0$*9B|ռ ܼ*.#>bx ɽѽ,!( J'k$&߾ "4I7`ο+:*T1Nm .D`x -(&O"d$"%6k\^'/M`x;dAUd{ 8U.r* %<Od~!2  5DY&i+  )>Rgw6G( 9CU[kq&xKeuQoJ7oJ=@@CGLRWZ^behloruy|  &),/369<?BEILORUX[^adgjmpsv}$'/$@@'e' )&A&h 2(/4=NWeD$''1OG  6+V9)+U0f!:  '4E)T~   7)Oy875 AH PZa&u  +&^<")AS [g{$$ E]n #." &-0T )% %;R/iP9$&,S&j$ ! /P,p$# L IWZ'$:_~MD[,XVO8'# *A^|  ,EXu   ?]w '#( A2t 1.1!`%$#3;BR%e'"3Lh   !!C[/d&6 ,ATe*wPK6?1v$//Nm}& );Le{6 /#@@'d5  !B7^A,1I-d!3 # @@a!x    .<LR Wa$!(%;Uq  &>E%#7> EOb|%#.Ap% C&d%,(*(S'|32+I [|3 $>&Ry !(DX'w&-  $2AR'g(E%e$  &2 Cd5"* = KV'_ $ +A#Z'~"&Ff  7.:f587:H587:*5e87: 5G 8}   (  ! 5 E e        4 9 /@@ 'p  "       " 2 F  ] j (|        ) : $P %u   " $ ,'Jr.y+!>!`$ 8Hbx(E^fo ! 4EYw#+/ 7BAX( GF^]{ n\  :DWs$+ K#l!* +7*bt'%3+Y   <!/^g,4#1X-4 !-Oo /<6< s$'0#X(|!  !B'\")" & @@ H [ b r        1!+6!b!!&!&!"! " " (" 4"@@" ["e""/"A"#A1#Qs####*$@@$V$ l$w$$$)$$$% /%l:%(%(%7%L1&~&&& &&&$&9& '#'")'L'_'q'''''''' '%(.(F(O(j(}(/(?('(')?)Q))i))%) )))(*,1*^*!z*&***)*(+#@@+d+z+++++ ,,2,F, \,g,#},k,- -3;- o-{--- ---n-n.v.&....&./1/D/T/Z/n/ ////$/ 0,0#>0$b0$000.0 1$1C1U1s1111112%42Z2v22 22 22223,3 ?3M3g3)m3#3 33334 44<B44D44;4)5:5C5 Y5c55555:5516:6)R6|6 6666626$7#=7/a727.778 8>8 Q8r8U8899/9E9V9p99+99#99:$:7:!V:#x:":":::;; .;O;d;|; ;;; ;;<< 4<?<V<]<p< <,<+<<!=#4=X=l= r=|======4={.>a> ??6?M?e?y?@@?c?2@@F@@U@@l@@s@@ x@@@@@@@@@@%@@ @@@@A(AEA.bA*A A"A AA B B9BOBgBB.BDBC#C5CNCeCvCC8CBC+%D QD[DbDwDD DDDDDDBEYZEKEFF!F'F7F>F!EF@@gFRFdF_`G@@G_H@@aHHHHHHHHHHHHHHHHHHHHHHHHHHHII I I'I*I-I0I3I6I9IJBJEJHJKJNJQJTJWJ[J^JaJM+="TUx,40YT^^\;8pkC@@('afoRKMOqS!'mPZ|6{%-q3Afk#_;6sS(2T YH,nQji!pk=NVQtF<Aw&9SDzE|Ry7}Ik~d8C_[XKZ\0]%/o:|K ;R FV 4G_Pf5h("9V%2H?m VNZ:jEI1rF-KB 9v;:Au~!bLyf \+mvdH+SegH7 0+g&J$68 hjzzlcA#IQ G RokN9HY"1Fae}W*`3Tn_rSMx*rmW&D2? U:!C[]CD^rflm<gtbn) >Us@@>Wy?w YXTy-c}2 d" bv>a|!5P }b,niEQu{p 5GA=\MB%)/- 1r1<Il(qZX"iup&4N$EhWM~Y6 (D0Ej^>.Bi3{24,G .+wDu|z~]5c'``Ol).zh8$b</=}R?W#O*%-];$,t/B?8[@@U*dn ).'O g&x3p@@sc` X1xXq[.eIoJ6o4L#atU]s`yjJedL'#w /xGca<NFiteO9  7~* J_:{=PCvV\q$P)0KZ 7 >JLl@@B^L[sQg37v{hw5u3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right Win3rd level of the "< >" keyA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL symbols (APLX unified)APL symbols (Dyalog APL)APL symbols (IBM APL2)APL symbols (Manugistics APL*PLUS II)APL symbols (SAX, Sharp APL for Unix)APL symbols (unified)Acer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Albanian (Veqilharxhi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt and Win behaviorAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium emulates Pause, PrtSc, Scroll LockApple laptopArabicArabic (AZERTY)Arabic (AZERTY, Eastern Arabic numerals)Arabic (Algeria)Arabic (Arabic numerals, extensions in the 4th level)Arabic (Buckwalter)Arabic (Eastern Arabic numerals)Arabic (Eastern Arabic numerals, extensions in the 4th level)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (QWERTY, Eastern Arabic numerals)Arabic (Sun Type 6/7)Arabic (Syria)ArmenianArmenian (OLPC, phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and L)Asus laptopAt the bottom leftAt the corresponding key in a Colemak layoutAt the corresponding key in a Dvorak layoutAt the corresponding key in a QWERTY layoutAtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Gitanjali)Bangla (India, Probhat)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (intl.)Belarusian (legacy)BelgianBelgian (ISO, alt.)Belgian (Latin-9 only, alt.)Belgian (Sun Type 6/7)Belgian (Sun dead keys)Belgian (Sun dead keys, alt.)Belgian (Wang 724 AZERTY)Belgian (alt.)Belgian (no dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh phonetic, alt.)Berber (Morocco, Tifinagh)BosnianBosnian (US)Bosnian (US, with Bosnian digraphs)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (enhanced)Bulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon (AZERTY, intl.)Cameroon (Dvorak, intl.)Cameroon Multilingual (QWERTY, intl.)Canadian (intl.)Canadian (intl., 1st part)Canadian (intl., 2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock as Ctrl, Ctrl as HyperCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles Shift Lock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (alt.)Cherry CyBo@@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCompatibility optionsComposeCopticCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US)Croatian (US, with Croatian digraphs)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt, Alt to WinCtrl is mapped to Win and the usual CtrlCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCurrency signsCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with <\|> key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Windows)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (Sun dead keys)Dutch (standard)DzongkhaElfdalian (Swedish, with combining ogonek)Enable APL overlay charactersEnable extra typographic charactersEnglish (3l)English (3l, Chromebook)English (3l, emacs)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Drix)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Macintosh, intl.)English (UK, Sun Type 6/7)English (UK, extended, Windows)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, Symbolic)English (US, alt. intl.)English (US, euro on 5)English (US, intl., AltGr Unicode combining)English (US, intl., AltGr Unicode combining, alt.)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (legacy)Esperanto letters with superscriptsEstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US)Estonian (no dead keys)EurKEY (US)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Dvorak)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Windows)Finnish (classic)Finnish (classic, no dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (AZERTY, AFNOR)French (BEPO)French (BEPO, AFNOR)French (BEPO, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Sun dead keys)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, Sun dead keys)French (Switzerland, no dead keys)French (Togo)French (US with dead keys, alt.)French (US)French (US, AZERTY)French (alt.)French (alt., Latin-9 only)French (alt., Sun dead keys)French (alt., no dead keys)French (legacy, alt.)French (legacy, alt., Sun dead keys)French (legacy, alt., no dead keys)French (no dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PCGeneric 104-key PCGeneric 104-key PC with L-shaped Enter keyGeneric 105-key PCGeneric 86-key PCGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, Sun dead keys)German (Austria, no dead keys)German (Bone)German (Bone, eszett in the home row)German (Dvorak)German (E1)German (E2)German (KOY)German (Ladin)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo, QWERTY)German (Neo, QWERTZ)German (QWERTY)German (Sun Type 6/7)German (Sun dead keys)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, Sun dead keys)German (Switzerland, legacy)German (Switzerland, no dead keys)German (T3)German (US)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters, no dead keys)German, Swedish and Finnish (US)GreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHanyu Pinyin (with AltGr dead keys)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HawaiianHebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa, phonetic)Hindi (Wx)Honeywell EuroboardHungarianHungarian (QWERTY)Hungarian (QWERTY, 101-key, comma, dead keys)Hungarian (QWERTY, 101-key, comma, no dead keys)Hungarian (QWERTY, 101-key, dot, dead keys)Hungarian (QWERTY, 101-key, dot, no dead keys)Hungarian (QWERTY, 102-key, comma, dead keys)Hungarian (QWERTY, 102-key, comma, no dead keys)Hungarian (QWERTY, 102-key, dot, dead keys)Hungarian (QWERTY, 102-key, dot, no dead keys)Hungarian (QWERTZ, 101-key, comma, dead keys)Hungarian (QWERTZ, 101-key, comma, no dead keys)Hungarian (QWERTZ, 101-key, dot, dead keys)Hungarian (QWERTZ, 101-key, dot, no dead keys)Hungarian (QWERTZ, 102-key, comma, dead keys)Hungarian (QWERTZ, 102-key, comma, no dead keys)Hungarian (QWERTZ, 102-key, dot, dead keys)Hungarian (QWERTZ, 102-key, dot, no dead keys)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (Sun dead keys)Icelandic (no dead keys)IgboIndianIndonesian (Arab Melayu, extended phonetic)Indonesian (Arab Melayu, phonetic)Indonesian (Javanese)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Ladin)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US)Italian (Windows)Italian (intl., with dead keys)Italian (no dead keys)JapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7, PC-compatible)Japanese (Sun Type 7, Sun-compatible)Japanese keyboard optionsKabylian (Algeria, Tifinagh)Kabylian (azerty layout, no dead keys)Kabylian (azerty layout, with dead keys)Kabylian (qwerty-gb layout, with dead keys)Kabylian (qwerty-us layout, with dead keys)KalmykKana Lock key is lockingKannadaKannada (KaGaPa, phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104-key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA)LatvianLatvian (Colemak)Latvian (Colemak, with apostrophe)Latvian (Dvorak)Latvian (Dvorak, with Y)Latvian (Dvorak, with minus)Latvian (F)Latvian (Sun Type 6/7)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer Dvorak)Latvian (programmer Dvorak, with Y)Latvian (programmer Dvorak, with minus)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (Dvorak)Lithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional Esc, but Shift + Caps Lock is the regular Caps LockMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (UK, with AltGr overrides)Maltese (US layout with AltGr overrides)Maltese (US)Manipuri (Eeyek)MaoriMarathi (KaGaPa, phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMmuockModi (KaGaPa phonetic)MoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian (Galik)Mongolian (Manchu Galik)Mongolian (Manchu)Mongolian (Todo Galik)Mongolian (Todo)Mongolian (Xibe)MontenegrinMontenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Cyrillic, with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Montenegrin (Latin, with guillemets)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Non-breaking space inputNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Windows)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrows. Num Lock off: arrows (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOld Hungarian (for ligatures)Old Solaris keycodes compatibilityOld TurkicOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Windows)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)Phone and ATM stylePolishPolish (British keyboard)Polish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, Sun dead keys)Portuguese (Macintosh, no dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (Sun dead keys)Portuguese (no dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Windows)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Belarus)Russian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic Macintosh)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, Windows)Russian (phonetic, YAZHERTY)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamogitianSamsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa, phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic, ZE and ZHE swapped)Serbian (Cyrillic, with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Latin, with guillemets)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US)Sinhala (phonetic)SlovakSlovak (ACC layout, only accented letters)Slovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, Sun dead keys)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Sun dead keys)Spanish (Windows)Spanish (dead tilde)Spanish (no dead keys)Special keys (Ctrl+Alt+<key>) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Sun key compatibilitySuper Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap Esc and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Dvorak, intl.)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa, phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)The "< >" keyThe "< >" key chooses 5th levelThe "< >" key chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserThe "< >" key; acts as onetime lock when pressed together with another 3rd level chooserTibetanTibetan (with ASCII numerals)To the left of "A"Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (Sun dead keys)Turkish (intl., with dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Windows)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode arrows and math operatorsUnicode arrows and math operators on default levelUnitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Windows)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to indicate modifiersUse keyboard LED to show alternative layoutUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French)Vietnamese (QĐERTY)Vietnamese (US)ViewSonic KU-306 InternetWang 724 keypad with Unicode arrows and math operatorsWang 724 keypad with Unicode arrows and math operators on default levelWin is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.30.99 d53 1 a53 1 PO-Revision-Date: 2020-09-24 21:50+0200 d62 1 a62 1 Niveau 3 de Verr. Maj.Niveau 3 de la touche Ctrl de gaucheNiveau 3 de la touche Windows de gaucheNiveau 3 de menuNiveau 3 de la touche Ctrl de droiteNiveau 3 de la touche Windows de droiteNiveau 3 de la touche « < > »A4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSymboles APL (APLX unifié)symboles APL (APL Dyalog)Symboles APL (IBM APL2)Symboles APL (Manugistics APL*PLUS II)Symboles APL (SAX, Sharp APL for Unix)Symboles APL (unifiés)Acer AirKey VAcer C300Acer Ferrari 4000Acer (portable)Ajouter du comportement standard à la touche MenuAdvance Scorpius KIAfghanAkanAlbanaisAlbanais (Plisi)Albanais (Veqilharxhi)Autorise des actions clavier à casser les captures (attention : faille de sécurité)Autorise l'enregistrement des captures et arborescences de fenêtresAlt et Meta sont sur les touches AltComportement des touches Alt et WindowsAlt est placé sur Windows droite, Super sur MenuAlt est placé sur les touches Windows (et les touches Alt habituelles)Alt échangé avec WindowsAlt+Verr. maj.Alt+CtrlAlt+Maj.Alt+EspaceAmhariqueN'importe quelle touche AltN'importe quelle touche WindowsN'importe quelle touche Windows (maintenue)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium émule Pause, Impr. écr., Arrêt défil.Apple (portable)ArabeArabe (AZERTY)Arabe (AZERTY, chiffres arabes orientaux)Arabe (Algérie)Arabe (chiffres arabes, extensions au 4e niveau)Arabe (Buckwalter)Arabe (chiffres arabes orientaux)Arabe (chiffres arabes orientaux, extensions au 4e niveau)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (QWERTY)Arabe (QWERTY, chiffres arabes orientaux)Arabe (Sun type 6/7)Arabe (Syrie)ArménienArménien (OLPC, phonétique)Arménien (variante orientale)Arménien (variante phonétique)Arménien (orientale)Arménien (phonétique)Arménien (occidentale)Asturien (Espagne, avec H et L point bas)Asus (portable)En bas à gaucheÀ la touche correspondante sur une disposition Colemak.À la touche correspondante sur une disposition Dvorak.À la touche correspondante d'une disposition QWERTY.AtsinaAvatimeAvestiqueAzériAzéri (cyrillique)Azona RF2300 clavier internet sans filBTC 5090BTC 5113RF multimédiaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarre oblique inverseLa barre oblique inverse, avec un autre sélecteur de niveau 3, verrouille une fois ce niveauBambaraBengaliBengali (Inde)Bengali (Inde, Inscript Baishakhi)Bengali (Inde, Baishakhi)Bengali (Inde, Bornona)Bengali (Inde, Gitanjali)Bengali (Inde, Probhat)Bengali (Probhat)BachkirBiélorusseBiélorusse (latin)Biélorusse (international)Biélorusse (obsolète)BelgeBelge (ISO, variante)Belge (variante, Latin-9 uniquement)Belge (Sun type 6/7)Belge (touches mortes Sun)Belge (variante, touches mortes Sun)Belge (Wang 724 AZERTY)Belge (variante)Belge (sans touche morte)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbère (Maroc, variante Tifinagh)Berbère (Maroc, Tifinagh étendu phonétique)Berbère (Maroc, Tifinagh étendu)Berbère (Maroc, Tifinagh phonétique)Berbère (Maroc, Tifinagh phonétique, variante)Berbère (Maroc, Tifinagh)BosniaqueBosniaque (US)Bosniaque (US, avec digraphes bosniaques)Bosniaque (avec digraphes bosniaques)Bosniaque (avec guillemets)Les deux Alt ensembleLes deux Ctrl ensembleLes deux Maj. ensembleLes 2 touches Maj. ensemble activent Verr. maj.Les 2 touches Maj. ensemble activent le Verr. maj., la touche Maj. le désactiveLes 2 touches Maj. ensemble activent le blocage majusculeBrailleBraille (pour gaucher, pouce inversé)Braille (pour gaucher)Braille (pour droiter, pouce inversé)Braille (pour droiter)Brother InternetBulgareBulgare (amélioré)Bulgare (nouvelle phonétique)Bulgare (phonétique traditionnelle)BirmanBirman ZawgyiCameroun (AZERTY, international)Anglais (Dvorak, international)Cameroun multilingue (QWERTY, international)Canadien (international)Canadien (international, 1re partie)Canadien (international, 2e partie)Verr. maj.Verr. maj. (maintenu), Alt + Verr. maj. joue le rôle original de Verr. maj.Verr. maj. agit comme un verrouillage Maj ; Maj. l'annule temporairementVerr. maj. agit comme Maj. quand il est verrouillé ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj. comme CtrlVerr. maj. comme Ctrl, Ctrl comme HyperComportement de la touche Verr. maj.Verr. maj. est également CtrlVerr. maj. est désactivéVerr. maj. (première disposition), Maj. + Verr. maj. (dernière disposition)Verr. maj. bascule le blocage majuscule (affecte toutes les touches)Verr. maj. active ou désactive la mise en majuscule usuelle des caractères alphabétiquesVerr. maj. utilise la mise en majuscule interne ; Maj. annule temporairement Verr. maj.Verr. maj. utilise la mise en majuscule interne ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj., avec un autre sélecteur de niveau 3, verrouille une fois ce niveauCatalan (Espagne, avec L point médian)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (variante)Cherry CyBo@@rd concentrateur USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony internetChicony KB-9885Chicony KU-0108Chicony KU-0108ChinoisChromebookLiturgique slaveChuvashTchouvache (latin)Classmate PCCló GaelachSalish Cœur d'AlèneCompaq Armada (portable)Compaq Easy AccessCompaq Internet (13 touches)Compaq Internet (18 touches)Compaq Internet (7 touches)Compaq Presario (portable)Compaq iPaqOptions de compatibilitéCompositionCopteCreative Desktop Wireless 7000Tatar de Crimée (Q dobroudja)Tatar de Crimée (Alt-Q turc)Tatar de Crimée (F turc)Tatar de Crimée (Q turc)CroateCroate (US)Croate (US, avec les digraphes croates)Croate (avec les digraphes croates)Croate (avec guillemets)Ctrl est placé sur Alt, Alt sur WindowsCtrl est placé sur les touches Windows (et les Ctrl habituelles)Position de CtrlCtrl+Alt+Eff. arrièreCtrl+Maj.MonnaiesTchèqueTchèque (QWERTY)Tchèque (QWERTY, Macintosh)Tchèque (QWERTY, barre oblique inverse étendue)Tchèque (Sun type 6/7)Tchèque (UCW, lettres accentuées uniquement)Tchèque (Dvorak US, support UCW)Tchèque (codage)Tchèque (programmation)Tchèque (programmation, typographie)Tchèque (typographie)Tchèque (avec la touche <\|>)Tchèque, slovaque et allemand (US)DTK2000DanoisDanois (Dvorak)Danois (Macintosh)Danois (Macintosh, sans touche morte)Danois (Sun type 6/7)Danois (Windows)Espagnol (sans touche morte)Touches du pavé numérique par défautDellDell PC 101 touchesDell Inspiron 6000/8000 (portable)Dell Latitude (portable)Dell Precision M (portable)Dell Precision M65 (portable)Dell SK-8125Dell SK-8135Dell USB MultimédiaDexxa Wireless DesktopDivehiDiamond 9801/9802NéerlandaisNéerlandais (Macintosh)Danois (Sun type 6/7)Néerlandais (touches mortes Sun)Néerlandais (standard)DzongkhaDalécarlien (Suède, avec ogonek combinatoire)Active les caractères APL superposésActive des caractères typographiques supplémentairesAnglais (3l)Anglais (3l, Chromebook)Anglais (3l, Emacs)Anglais (Australien)Anglais (Cameroun)Anglais (Canada)Anglais (Carpalx)Anglais (Carpalx, complètement optimisé)Anglais (Carpalx, complètement optimisé, internat., touches mortes via AltGr)Anglais (Carpalx, complètement optimisé, internat., avec touches mortes)Anglais (Carpalx, internat., touches mortes via AltGr)Anglais (Carpalx, internat., avec touches mortes)Anglais (Colemak)Anglais (Drix)Anglais (Dvorak)Anglais (Dvorak, variante internat.)Anglais (Dvorak, internat. avec touches mortes)Anglais (Dvorak, pour gaucher)Anglais (Dvorak pour droitier)Anglais (Ghana)Anglais (Ghana, GILLBT)Anglais (Ghana, multilingue)Anglais (Inde, avec le symbole Roupie)Anglais (Macintosh)Anglais (Mali, US, Macintosh)Anglais (Mali, US, internat.)Anglais (Nigeria)Anglais (Norman)Anglais (Afrique du Sud)Anglais (Royaume-Uni)Anglais (Royaume-Uni, Colemak)Anglais (Royaume-Uni, Dvorak)Anglais (Royaume-Uni, Dvorak, ponctuation britannique)Anglais (Royaume-Uni, Macintosh)Anglais (Royaume-Uni, Macintosh, international)Anglais (Royaume-Uni, Sun type 6/7)Anglais (Royaume-Uni, étendu, Windows)Anglais (Royaume-Uni, internat., avec touches mortes)Anglais (US)Anglais (US, Arabe IBM 238_L)Anglais (US, Sun type 6/7)Anglais (US, symbolique)Anglais (US, variante internat.)Anglais (US, Euro sur le 5)Anglais (US, international, AltGr combinatoire Unicode)Anglais (US, international, AltGr combinatoire Unicode, variante)Anglais (US, internat., avec touches mortes)Anglais (Workman)Anglais (Workman, internat., avec touches mortes)Anglais (Dvorak classique)Anglais (internat., touches mortes via AltGr)Anglais (Dvorak pour programmeur)Anglais (diviser/multiplier bascule la disposition)Ennyah DKB-1008Entrée sur le pavé numériqueEspérantoEspéranto (Brésil, Nativo)Espéranto (Portugal, PT-Nativo)Espéranto (obsolète)Lettres espéranto avec exposantsEstonienEstonien (Dvorak)Estonien (Sun type 6/7)Estonien (US)Estonien (sans touche morte)EurKEY (US)Euro sur le 2Euro sur le 4Euro sur le 5Euro sur le EEverex STEPnoteÉwéFL90FéroïenFéroïen (sans touche morte)FilipinoFilipino (Capewell-Dvorak, baybayin)Filipino (Capewell-Dvorak, latin)Filipino (Capewell-QWERF 2006, baybayin)Filipino (Capewell-QWERF 2006, latin)Filipino (Colemak, baybayin)Filipino (Colemak, latin)Filipino (Dvorak, baybayin)Filipino (Dvorak, latin)Filipino (QWERTY, baybayin)FinnoisFinnois (DAS)Finnois (Dvorak)Finnois (Macintosh)Finnois (Sun type 6/7)Finnois (Windows)Finnois (classique)Finnois (classique, sans touche morte)Touche à quatre niveaux avec le séparateur décimal abstraitTouche à quatre niveaux avec virguleTouche à quatre niveaux avec pointTouche à quatre niveaux avec point, Latin-9 uniquementTouche à quatre niveaux avec le séparateur décimal momayyezFrançaisFrançais (AZERTY)Français (AZERTY, AFNOR)Français (BÉPO)Français (BÉPO, AFNOR)Français (BÉPO, Latin-9 uniquement)Français (breton)Français (Cameroun)Français (Canada)Français (Canada, Dvorak)Français (Canada, obsolète)Français (République démocratique du Congo)Français (Dvorak)Français (Guinée)Français (Macintosh)Français (Mali, variante)Français (Maroc)Français (Sun type 6/7)Français (touches mortes Sun)Français (Suisse)Français (Suisse, Macintosh)Français (Suisse, Sun type 6/7)Français (Suisse, touches mortes Sun)Français (Suisse, sans touche morte)Français (Togo)Français (US avec touches mortes, variante)Français (US)Français (US, AZERTY)Français (variante)Français (variante, Latin-9 uniquement)Français (variante, touches mortes Sun)Français (variante, sans touche morte)Français (obsolète, variante)Français (obsolète, variante, touches mortes Sun)Français (obsolète, variante, sans touche morte)Français (sans touche morte)Frioulan (Italie)Fujitsu-Siemens Amilo (portable)PeulGaPC générique 101 touchesPC générique 102 touchesPC générique 104 touchesPC générique 104 touches avec touche Entrée en LPC générique 105 touchesPC générique 86 touchesGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGéorgienGéorgien (France, AZERTY Tskapo)Géorgien (Italie)Géorgien (MESS)Géorgien (ergonomique)AllemandAllemand (Aus der Neo-Welt)Allemand (Autriche)Allemand (Autriche, Macintosh)Allemand (Autriche, touches mortes Sun)Allemand (Autriche, sans touche morte)Allemand (Bone)Allemand (Bone, ß dans la rangée du milieu)Allemand (Dvorak)Allemand (E1)Allemand (E2)Allemand (KOY)Allemand (Ladin)Allemand (Macintosh)Allemand (Macintosh, sans touche morte)Allemand (Neo 2)Allemand (Neo, QWERTY)Allemand (Neo, QWERTZ)Allemand (QWERTY)Allemand (Sun type 6/7)Allemand (touches mortes Sun)Allemand (Suisse)Allemand (Suisse, Macintosh)Allemand (Suisse, Sun type 6/7)Allemand (Suisse, touches mortes Sun)Allemand (Suisse, obsolète)Allemand (Suisse, sans touche morte)Allemand (T3)Allemand (US)Allemand (accent aigu en touche morte)Allemand (accents aigu et grave en touches mortes)Allemand (tilde en touche morte)Allemand (sans touche morte)Allemand (avec lettres hongroises, sans touche morte)Allemand, suédois et finnois (US)GrecGrec (Colemak)Grec (Sun type 6/7)Grec (étendu)Grec (sans touche morte)Grec (polytonique)Grec (simple)GujarâtîGyrationHanyu Pinyin (touches mortes via AltGr)Happy HackingHappy Hacking pour MacHaoussa (Ghana)Haoussa (Nigeria)HawaïenHébreuHébreu (biblique, SIL, phonétique)Hébreu (biblique, Tiro)Hébreu (lyx)Hébreu (phonétique)Hewlett-Packard InternetHewlett-Packard Mini 110 (portable)Hewlett-Packard NEC SK-2500 MultimédiaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadécimalHindi (bolnagri)Hindi (KaGaPa, phonétique)Hindi (Wx)Honeywell EuroboardHongroisHongrois (QWERTY)Hongrois (QWERTY, 101 touches, virgule, touches mortes)Hongrois (QWERTY, 101 touches, virgule, sans touche morte)Hongrois (QWERTY, 101 touches, point, touches mortes)Hongrois (QWERTY, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (QWERTZ, 101 touches, virgule, touches mortes)Hongrois (QWERTZ, 101 touches, virgule, sans touche morte)Hongrois (QWERTZ, 101 touches, point, touches mortes)Hongrois (QWERTZ, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (sans touche morte)Hongrois (standard)Hyper est placé sur les touches WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandaisIslandais (Dvorak)Islandais (Macintosh)Islandais (Macintosh, obsolète)Islandais (touches mortes Sun)Islandais (sans touche morte)IgboIndienIndonésien (Arabe Malayu, phonétique étendu)Indonésien (Arabe Malayu, phonétique)Indonésien (Javanais)Alphabet phonétique internationalInuktitutIrakienIrlandaisIrlandais (UnicodeExpert)ItalienItalien (IBM 142)Italien (Ladin)Italien (Macintosh)Italien (Sun type 6/7)Italien (US)Italien (Windows)Italien (internat., avec touches mortes)Italien (sans touche morte)JaponaisJaponais (Dvorak)Japonais (Kana 86)Japonais (Kana)Japonais (Macintosh)Japonais (OADG 109A)Japonais (PC-98)Japonais (Sun type 6)Japonais (Sun type 7, compatible PC)Japonais (Sun type 7, compatible Sun)Options des claviers japonaisKabyle (Algérie, Tifinagh)Kabyle (azerty, sans touche morte)Kabyle (azerty, avec touches mortes)Kabyle (qwerty anglais, avec touches mortes)Kabyle (qwerty US, avec touches mortes)KalmykLa touche « verrouillage Kana » verrouilleKannadaKannada (KaGaPa, phonétique)CachoubeKazakhKazakh (latin)Kazakh (étendu)Kazakh (avec russe)Séquence de touches pour tuer le serveur XTouche sélectionnant le niveau 5Touche sélectionnant le niveau 3Keytronic FlexProKhmer (Cambodge)KikuyuKinesisKomiCoréenCoréen (compatible 101/104 touches)Coréen (Sun type 6/7)Touches Hangeul/Hanja coréennesKurde (Iran, arabe-latin)Kurde (Iran, F)Kurde (Iran, Alt-Q latin)Kurde (Iran, Q latin)Kurde (Irak, arabe-latin)Kurde (Irak, F)Kurde (Irak, Alt-Q latin)Kurde (Irak, Q latin)Kurde (Syrie, F)Kurde (Syrie, Alt-Q latin)Kurde (Syrie, Q latin)Kurde (Turquie, F)Kurde (Turquie, Alt-Q latin)Kurde (Turquie, Q latin)KutenaiKirghizeKirghize (phonétique)LaoLao (STEA)LettonLetton (Colemak)Letton (Colemak, avec apostrophe)Letton (Dvorak)Letton (Dvorak, avec Y)Letton (Dvorak, avec moins)Letton (F)Letton (Sun type 6/7)Letton (adapté)Letton (apostrophe)Letton (ergonomique, ŪGJRMV)Letton (moderne)Letton (Dvorak pour le programmeur)Letton (Dvorak pour le programmeur, avec Y)Letton (Dvorak pour le programmeur, avec moins)Letton (tilde)Disposition du pavé numériqueAlt gaucheAlt gauche (maintenu)Alt. gauche pour Ctrl, Ctrl pour Win, Win gauche pour Alt. gaucheAlt gauche échangé avec Windows gaucheAlt gauche+Maj. gaucheCtrl gaucheCtrl gauche comme MétaCtrl gauche (première disposition), Ctrl droit (dernière disposition)Ctrl gauche+Maj. gaucheCtrl gauche + Windows gaucheCtrl gauche + Windows gauche (première disposition), Ctrl droit + Menu (seconde disposition)Maj. gaucheTouche Windows gaucheWindows gauche (maintenu)Windows gauche sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauTouche Windows gauche (première disposition), touche Windows droite (dernière disposition)ObsolèteWang 724 (obsolète)Touche obsolète avec virguleTouche obsolète avec pointLituanienLituanien (Dvorak)Lituanien (IBM LST 1205-92)Lituanien (LEKP)Lituanien (LEKPa)Lituanien (Sun type 6/7)Lituanien (US)Lituanien (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (variante)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (variante 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTouches supplémentaires Logitech G15 via le démon G15Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bas-sorabeBas-sorabe (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (Internat.)MacédonienMacédonien (sans touche morte)MacintoshMacintosh (ancien)Faire de Verr. maj. un Effacement. arrière supplémentaire.Faire de Verr. maj. un Échap. supplémentaire.Faire de Verr. maj. un Échap. supplémentaire, mais Maj. + Verr. maj. a l'effet du Verr. maj. habituelFaire de Verr. maj. un Hyper supplémentaireFaire de Verr. maj. une touche Menu supplémentaire.Faire de Verr. maj. un Verr. Num. supplémentaireFaire de Verr. maj. un Super supplémentaire.Faire du Zenkaku Hankaku un Échap. supplémentaire.Alt. droite comme touche hangeulAlt. droite comme touche hanjaCtrl. droite comme touche hangeulCtrl. droite comme touche hanjaMalais (clavier jawi, arabe)Malais (jawi, phonétique)MalayâlamMalayâlam (lalitha)Malayâlam (Inscript amélioré avec le roupie)MaltaisMaltais (disposition anglaise avec des surcharges via AltGr)Maltais (disposition US avec des surcharges via AltGr)Maltais (US)Meitei (Eeyek)MaoriMarathi (KaGaPa, phonétique)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (maintenu), Maj.+Menu pour MenuMenu comme Ctrl droiteMenu est placé sur les touches WindowsMéta est placé sur Windows gaucheMéta est placé sur les touches WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (suédois)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB /Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Clavier Microsoft OfficeMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AM'mockModi (phonétique KaGaPa)MoldaveMoldave (Gagaouze)MongolMongol (bichig)Mongol (galik)Mongol (galik mandchou)Mongol (mandchou)Mongol (galik todo)Mongol (todo)Mongol (xibe)MonténégrinMonténégrin (cyrillique)Monténégrin (cyrillique, ZE et ZHE intervertis)Monténégrin (cyrillique, avec guillemets)Monténégrin (latin, QWERTY)Monténégrin (latin, Unicode)Monténégrin (latin, Unicode, QWERTY)Monténégrin (latin, avec guillemets)Multilingue (Canada, Sun type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Eff. Arr. du type NICOLA-FNépalaisEspace insécable au niveau 2Espace insécable au niveau 3Espace insécable au niveau 3, rien au niveau 4Espace insécable au niveau 3, espace fine insécable au niveau 4Espace insécable au niveau 4Espace insécable au niveau 4, espace fine insécable au niveau 6Espace insécable au niveau 4, espace fine insécable au niveau 6 (via Ctrl+Maj.)Entrée d'une espace insécableSami du Nord (Finlande)Sami du Nord (Norvège)Sami du Nord (Norvège, sans touche morte)Sami du Nord (Suède)Northgate OmniKey 101NorvégienNorvégien (Colemak)Norvégien (Dvorak)Norvégien (Macintosh)Norvégien (Macintosh, sans touche morte)Norvégien (Sun type 6/7)Norvégien (Windows)Norvégien (sans touche morte)Verr. Num.Verr. num. activé : chiffres ; maj. pour les flèches. Verr. num. désactivé : flèches (comme Windows)Touche numérique 4 pour un appui isoléTouche numérique 9 pour un appui isoléComportement de la touche de Suppr. du pavé numériqueLes touches du pavé numérique sont toujours numériques (comme sur Mac OS)OLPCOccitanOghamOgham (IS434)SantaliRunes HongroisesAncien hongrois (pour les ligatures)Compatibilité avec les anciens codes des touches SolarisTurc ancienOriyaOrtek MCK-800 Multimédia/InternetOssète (Géorgie)Ossète (Windows)Ossète (obsolète)PC-98Ruthène pannonienPosition des parenthèsesPachtoPachto (Afghanistan, OLPC)PausePersanPersan (Afghanistan, Dari, OLPC)Persan (avec pavé numérique persan)Type DAB ou téléphonePolonaisPolonais (clavier anglais)Polonais (Colemak)Polonais (Dvorak)Polonais (Dvorak, guillemets polonais sur le 1)Polonais (Dvorak, guillemets polonais sur la touche guillemets)Polonais (Allemagne, sans touche morte)Polonais (glagolitique)Polonais (QWERTZ)Polonais (Sun type 6/7)Polonais (internat., avec touches mortes)Polonais (obsolète)Polonais (Dvorak pour le programmeur)PortugaisPortugais (Brésil)Portugais (Brésil, Dvorak)Portugais (Brésil, ThinkPad IBM/Lenovo)Portugais (Brésil, Nativo pour claviers US)Portugais (Brésil, Nativo)Portugais (Brésil, Sun type 6/7)Portugais (Brésil, sans touche morte)Portugais (Colemak)Portugais (Macintosh)Portugais (Macintosh, touches mortes Sun)Portugais (Macintosh, sans touche morte)Portugais (Nativo pour claviers US)Portugais (PT-Nativo)Portugais (Sun type 6/7)Portugais (touches mortes Sun)Portugais (sans touche morte)Position de la touche ComposePropeller Voyager KTEZ-1000Impr. Écr.Penjabi (Gurmukhî, Jhelum)Penjabi (Gurmukhî)QTronix Scorpius 98N+Alt droiteAlt droite (maintenu)Alt droite sélectionne le niveau 5Alt. droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauAlt droite ne sélectionne jamais le niveau 3Alt droite, Maj. + Alt droite est la touche composeCtrl droiteCtrl droite (maintenu)Ctrl droite comme Alt droiteCtrl droite + Maj. droiteMaj. droiteWindows droiteWindows droite (maintenu)Windows droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauRoumainRoumain (Allemagne)Roumain (Allemagne, sans touche morte)Roumain (Sun type 6/7)Roumain (Windows)Roumain (cédille)Roumain (ergonomique dactylographique)Roumain (standard, cédille)Roumain (standard)Roupie sur le 4RusseRusse (Biélorusse)Russe (Tchèque, phonétique)Russe (DOS)Russe (Géorgie)Russe (Allemagne, phonétique)Russe (Allemagne, recommandé)Russe (Allemagne, translittération)Russe (Kazakhstan, avec kazakh)Russe (Macintosh)Russe (Pologne, Dvorak phonétique)Russe (polyglotte et réactionnaire)Russe (Rulemak, Colemak phonétique)Russe (Sun type 6/7)Russe (Suède, phonétique)Russe (Suède, phonétique, sans touche morte)Russe (US, phonétique)Russe (Ukraine, RSTU standard)Russe (obsolète)Russe (Macintosh phonétique)Russe (phonétique)Russe (phonétique, AZERTY)Russe (phonétique, Dvorak)Russe (phonétique, français)Russe (phonétique, Windows)Russe (phonétique, YAZHERTY)Russe (machine à écrire)Russe (machine à écrire, obsolète)Russe (avec ponctuation US)Russe (Ukrainien-Biélorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taïwan)SamogitienSamsung SDM 4500PSamsung SDM 4510PSanscrit (KaGaPa, phonétique)Sanwa Supply SKB-KG3Arrêt défilementSecwepemctsinPoint-virgule au niveau 3SerbeSerbe (cyrillique, ZE et ZHE intervertis)Serbe (cyrillique, avec guillemets)Serbe (Latin)Serbe (Latin, QWERTY)Serbe (latin, Unicode)Serbe (latin, Unicode, QWERTY)Serbe (Latin, avec guillemets)Serbe (Russe)Serbe (accents combinatoires à la place des touches mortes)Serbo-Croate (US)Maj. + VerrNum bascule le contrôle souris au clavier (PointerKeys) Maj. annule Verr. maj.Maj. n'annule pas Verr. num., mais sélectionne le niveau 3Maj.+ Verr. maj.SicilienSicilien (clavier US)SilésienSilvercrest Multimedia WirelessSindhîCingalais (US)Cingalais (phonétique)SlovaqueSlovaque (disposition ACC, lettres accentuées uniquement)Slovaque (QWERTY)Slovaque (QWERTY, barre oblique inverse étendue)Slovaque (Sun type 6/7)Slovaque (barre oblique inverse étendue)SlovèneSlovène (US)Slovène (avec guillemets)EspagnolEspagnol (Dvorak)Espagnol (Amérique latine)Espagnol (Amérique latine, Colemak spécial jeux)Espagnol (Amérique latine, Colemak)Espagnol (Amérique latine, Dvorak)Espagnol (Amérique latine, touches mortes Sun)Espagnol (Amérique latine, tilde en touche morte)Espagnol (Amérique latine, sans touche morte)Espagnol (Macintosh)Espagnol (Sun type 6/7)Espagnol (touches mortes Sun)Espagnol (Windows)Espagnol (tilde en touche morte)Espagnol (sans touche morte)Les combinaisons spéciales (Ctrl+Alt+<touche>) sont traitées par le serveur XSteelSeries Apex 300 (Apex RAW)Sun type 6 (Japon)Sun type 6 USB (Japon)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europe)Sun type 7 USBSun type 7 USB (Europe)Sun type 7 USB (Japon)/Japonais 106 touchesSun type 7 USB (Unix)Compatibilité avec les touches SunSuper Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Intervertir Ctrl et Verr. maj.Intervertir Échap. et Verr. maj.Échange Alt. gauche et Ctrl gaucheÉchange Win gauche et Ctrl gaucheÉchange Win droite et Ctrl droiteÉchangé avec les crochetsSuédoisSuédois (Dvorak A5)Suédois (Dvorak)Suédois (Dvorak, international)Suédois (Macintosh)Suédois (Sun type 6/7)Suédois (Svdvorak)Suédois (US)Suédois (sans touche morte)Langue des signes suédoisePassage à une autre dispositionSymplon PaceBook (tablette)SyriaqueSyriaque (phonétique)TaïwanaisTaïwanais (indigène)TadjikTadjik (obsolète)Tamoul (Inscript)Tamoul (Sri Lanka, TamilNet '99)Tamoul (Sri Lanka, TamilNet '99, codage TAB)Tamoul (TamilNet '99 avec chiffres tamouls)Tamoul (TamilNet '99)Tamoul (TamilNet '99, codage TAB)Tamoul (TamilNet '99, codage TSCII)Targa Visionary 811TatarTélougouTélougou (KaGaPa, phonétique)Télougou (Sarala)ThaïThaï (Pattachote)Thaï (TIS-820.2538)La touche « < > »La touche « < > » sélectionne le niveau 5La touche « < > » sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauLa touche « < > », avec un autre sélecteur de niveau 3, verrouille une fois ce niveauTibétainTibétain (avec chiffres ASCII)À gauche du « A »Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (touches Alt larges)Truly Ergonomic Computer Keyboard Model 229 (touches Alt de taille standard, touches Super et Menu)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Allemagne)Turc (Sun type 6/7)Turc (touches mortes Sun)Turc (internat., avec touches mortes)TurkmèneTurkmène (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)OudmourteOugaritique à la place de l'arabeUkrainienUkrainien (Sun type 6/7)Ukrainien (Windows)Ukrainien (homophonique)Ukrainien (obsolète)Ukrainien (phonétique)Ukrainien (RSTU standard)Ukrainien (machine à écrire)Opérateurs mathématiques et flèches UnicodeOpérateurs mathématiques et flèches Unicode au niveau par défautUnitek KB-1925Ourdou (Pakistan)Ourdou (Pakistan, CRULP)Ourdou (Pakistan, NLA)Ourdou (Windows)Ourdou (variante phonétique)Ourdou (phonétique)Utiliser les LED clavier pour indiquer les modificateursUtiliser les LED clavier pour indiquer une disposition alternativeL'espace habituelle quel que soit le niveauOuïghourOuzbekOuzbek (Afghanistan)Ouzbek (Afghanistan, OLPC)Ouzbek (latin)VietnamienVietnamien (AÐERTY)Vietnamien (français)Vietnamien (QĐERTY)Vietnamien (US)ViewSonic KU-306 InternetPavé Wang 724 avec opérateurs mathématiques et flèches UnicodePavé Wang 724 avec opérateurs mathématiques et flèches Unicode au niveau par défautLa touche Windows est placé sur Impr. écr. (en plus de la touche Windows)Windows+EspaceWinbook Model XP5WolofYahoo! InternetIakuteYorubaAntiliant sans chasse au niveau 2Antiliant sans chasse au niveau 2. espace insécable au niveau 3Antiliant sans chasse au niveau 2, espace insécable au niveau 3, rien au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, espace fine insécable au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, liant sans chasse au niveau 4Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3, espace insécable au niveau 4Antiliant sans chasse au niveau 3, liant sans chasse au niveau 4akamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 (portable)eeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh@ 1.1.1.4 log @initial import of xkeyboard-config-2.32 @ text @d1 61 a61 62 &U L`eaexeeeee e f f!fAfEf`fyf%f%ff f g g g%(gNgbgjgogxggCg"ghh)4h&^hh hh h hhhhhhhi+i2Ai tiii(ii5ij j==j{jj jjj(jjkk&k@@kXkqkkk)k kk,k+!l+Mlylll lllll l lm m m %m+/m [mTemmmm"mmn-nGn_n pn {nnnnnnnno*o9o Po]onoooo,o#o##p)Gpqpp p#ppppq$q$8q?]q%qq$qq%r,rCr Tr^rsr rrrrr%rs-sHs csJms>sEs=t Otptt9t/t@@u@@DuGuTu""vEvNvavzvvvvvww$w4wDw LwWwgwow w wwwwwwx!x 8xDxZxbxixxxxxx x% y!1ySy!ny(y yy yyyy z"#zFz"[z~z zz zzz{.{6{={M{ `{{{{{{{{|#|;| U| b|o|||||||||*|&}#D} h}u}}}}}}$}2~AE~O~;~I.]('A_~Ā,>O fs)3Ql#1΂445 jwσ689o9,:(=c=2߅#6(Hq%/̆ &A^#q ȇև   "26;CZ$c!(%ӈ0Le Ӊ'?Y%qˊ !1CSk)Ћ  "@@"c  Ռ#1Uk|Ǎ*ڍ*&>e ͎ގ $5Q p%~ ُ̏ +@@Ue{"Ӑ"  +?Ym- ґؑ#5DM#V z Œ̒ #<&\"#Cc  ͔ؔ - 07+h.-Õ0+".N-}0+ܖ.-70e+.— 6G[k ɘӘ &+0"\ ř˙ 0 GTf˚ۚ$,%Qw!$$؛% @@JQ`r!œޜ $,18Xnҝ5M`}Ȟ ",O`y ˟#*'Nv8! 0:4LD `7|ˢ 1CVjã ݣ #?!c( +Ϥ%!3Ie'våӥ%) BPg{  Ʀ&Ԧ! P>"%%ا"&!Hd֨ ) 5"=(` ȩ )%Obyݪ # ;\&v")"9@@ Wa t~Ϭ *+'V~$$ܭ# % 3 ? K Wc|##=ˮM #WM{^ɯ(AZ%r ưа# 1J^wK&̱&19kpx ~ " !*=OUez ˳/C,S4Դ ,< Wbv(,!!&H]$t$Ҷ:@@Zm a÷!%%G mx ¸ θظaT] p۹  .<Nj"!κ!"#'Kb(} ޻ :Upۼ+% 9G Ydv ʽ ֽ&#,P`x Ӿ0$)N9fпٿ   *'R#b ,!L n$&-7D|*8cy2Qks (D\c u-( 3"H$k%k@@^ 1D\p 2:Jc.* #<Pgz!2$4K`o&+ ! ; ITi}6G(; dn&Keu|oJboJhknrw} !%(+.147:=ADGJQTWZ^adgjmptwz}    #&)-036$'Bj${''  *.Jd&|&  2OcjoxWD$='b1G.7 @@ KUq+9@@QW)f0!:B T bo)  #DZr)875F| &   ++5a^w"2Jd| $+@@Xi #.">&a0 )%=Yo/P9X&`& $)N U c,$# 3L>IZ0'F$nMD[AXVOM'# ?Vs   +AZm  5Tr '#(AG 1..F!u%$#$HPWg%z' "%Ha}   6N/W&6  4GX*j=Pc$K]621i$/7Vu&1CTm!6( B/c+#+'57HmKK N[{"" H4K}K;1OmQQEa,1-3!a3  0!Gir   ! &0N$W!|(% $@@Yu }&>%S#y7> 1K]%v.?Rh %&,7ds('2Ca s3!<V&j !7@@\p&-  "1B'W7$T y &2 5-"c   '  3 A X h z  $     # '* R o "     2 O  f s      7 : 5M 8 7 : 5/ 8e 7 : 58G7:58)b( . OYl  /'"( KU ]g (/KTfy$%%C'c". ):+N!z!! $D [|0A\s ! -=U q|#+ /6fu A(! 8DG\] 7CYns\ ?I^|  /DM]$w #!*# N+o7'(P`u%+ ) IU u<,/g, , 4 1 -(!4V! !!!!! "*" E"P"/e""<"6" ##-#3#Q#o#t####$###' $#2$(V$$$!$$$ $%'6%"^%)%%%"%%&&"&5&<&L&[&s&& & & &&1&+'<'Z'&y'&'"' ' ' ( ( ((( C(M(k(/(A((A)Q[))))*)(*>* T*_*t**)**** +l"+(+(+7+L,f,k,s, y,,,$,9, , -"-4-G-Y-m-s------ -%-...7.R.e.{./.?.'.%/=/O/)g//%/ ///(0,/0\0!x0&000(0#181N1g111 1111 22#22kV2-232 $303G3d3 333n3#4+4&?4f4}4&444444 55.5M5$l555#5$5$ 616F6.b666666 7(7D7c777%7778 -8;8 N8Y8k8}8888 888)9#.9 R9`9v999 9<9:D(:m:;:::: ::;";1;I;:R;;1;;);< <*<E<N<`<2|<$<#<2<.+=Z=o== ==U=.>N>a>x>>>>>+> ?#"?F?]?m??!?#?"?"@@+@@G@@P@@e@@ w@@@@@@@@ @@@@A AAA]AfA }AAAAA A,A+BEB![B#}BBB BBBBBC&C4BC{wCaC UD_DDDDDDDDEE E)E2ECE%WE }EEEEE.E*F FF"PF sF}FFFFFF G.*GDYGGGGGGHH83HBlH+H HHHII +I6IKIbIwIIBIYIK>JJJJJJJ!J@@JR2KdK_K@@JL_L@@L,M/M2M6M;MAMFMIMMMQMTMWM[M^MaMdMhMkMnMqMuMxM|MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNN N NNNNNN"N&N)N,N/N2N5N8NVF1f&$\ZA`%4LW BQ-Rk Ro jT1uCr _W# h&0Hue'q?];Gw_ac?UdvD3,#<S}GT\+igSg=]P 7HyaF02B=E,f<q^O_~a z!7^{+o|7tG:\];}^(<m9Q*}wI*vH5[KlvPS8~BtWiqU6:3]{rb$ft)0YX#6,fnN602e9mpb)EgTLlV.F_MN\}Y7#QszN 4:5a@@7J e %+uGWKobVmU*4r)<M(.gxjX8>h` xD1L4;Z/; n?L{Ujka_^ v>i ?b&.$xCE Y@@3r 2+8 Ej Rz*@@t3vI'1B)F^;{"%yjoS]2~D=+/3pKD %O  p'<nlxKBJs5 $cw5fd)eyPk-m/9ly(.V&A[WedIR~`Ap5|XUQO= PHr/!`pVh9wTKq.,Zddk0b6@@!(Z/[Y~-u'F:"C >[gRN!:IAi Cml n|*%z>Xh!cO -st@@A8o MsiLQ|"1?yx'G-DYJ($MEzqIu Sc4T XMN"k},6n3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right Win3rd level of the "< >" keyA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL symbols (APLX unified)APL symbols (Dyalog APL)APL symbols (IBM APL2)APL symbols (Manugistics APL*PLUS II)APL symbols (SAX, Sharp APL for Unix)APL symbols (unified)Acer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Albanian (Veqilharxhi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt and Win behaviorAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium emulates Pause, PrtSc, Scroll LockApple laptopArabicArabic (AZERTY)Arabic (AZERTY, Eastern Arabic numerals)Arabic (Algeria)Arabic (Arabic numerals, extensions in the 4th level)Arabic (Buckwalter)Arabic (Eastern Arabic numerals)Arabic (Eastern Arabic numerals, extensions in the 4th level)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (QWERTY, Eastern Arabic numerals)Arabic (Sun Type 6/7)Arabic (Syria)ArmenianArmenian (OLPC, phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and L)Asus laptopAt the bottom leftAt the corresponding key in a Colemak layoutAt the corresponding key in a Dvorak layoutAt the corresponding key in a QWERTY layoutAtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Gitanjali)Bangla (India, Probhat)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (intl.)Belarusian (legacy)BelgianBelgian (ISO, alt.)Belgian (Latin-9 only, alt.)Belgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt.)Belgian (no dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh phonetic, alt.)Berber (Morocco, Tifinagh)BosnianBosnian (US)Bosnian (US, with Bosnian digraphs)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (enhanced)Bulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon (AZERTY, intl.)Cameroon (Dvorak, intl.)Cameroon Multilingual (QWERTY, intl.)Canadian (intl.)Canadian (intl., 1st part)Canadian (intl., 2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock as Ctrl, Ctrl as HyperCaps Lock behaviorCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles Shift Lock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (alt.)Cherry CyBo@@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCompatibility optionsComposeCopticCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US)Croatian (US, with Croatian digraphs)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt, Alt to WinCtrl is mapped to Win and the usual CtrlCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCurrency signsCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with <\|> key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Windows)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)DzongkhaElfdalian (Swedish, with combining ogonek)Enable APL overlay charactersEnable extra typographic charactersEnglish (3l)English (3l, Chromebook)English (3l, emacs)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, Hyena Layer5)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with AltGr dead keys, Hyena Layer5)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, full optimization, intl., with dead keys, Hyena Layer5)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Colemak-DH)English (Drix)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Colemak-DH)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Hyena Layer5)English (UK, Macintosh)English (UK, Macintosh, intl.)English (UK, MiniGuru Layer5)English (UK, Sun Type 6/7)English (UK, TEX Yoda Layer5)English (UK, extended, Windows)English (UK, intl., with dead keys)English (UK, intl., with dead keys, Hyena Layer5)English (UK, intl., with dead keys, MiniGuru Layer5)English (UK, intl., with dead keys, TEX Yoda Layer5)English (US)English (US, Hyena Layer5)English (US, IBM Arabic 238_L)English (US, MiniGuru Layer5)English (US, Sun Type 6/7)English (US, Symbolic)English (US, TEX Yoda Layer5)English (US, alt. intl.)English (US, alt. intl., with dead keys, Hyena Layer5)English (US, alt. intl., with dead keys, MiniGuru Layer5)English (US, alt. intl., with dead keys, TEX Yoda Layer5)English (US, euro on 5)English (US, intl., AltGr Unicode combining)English (US, intl., AltGr Unicode combining, Hyena Layer5)English (US, intl., AltGr Unicode combining, MiniGuru Layer5)English (US, intl., AltGr Unicode combining, TEX Yoda Layer5)English (US, intl., AltGr Unicode combining, alt.)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (legacy)Esperanto letters with superscriptsEstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US)Estonian (no dead keys)EurKEY (US)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Dvorak)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Windows)Finnish (classic)Finnish (classic, no dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (AZERTY, AFNOR)French (BEPO)French (BEPO, AFNOR)French (BEPO, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Togo)French (US with dead keys, alt.)French (US)French (US, AZERTY)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (no dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PCGeneric 104-key PCGeneric 104-key PC with L-shaped Enter keyGeneric 105-key PCGeneric 86-key PCGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Bone)German (Bone, eszett in the home row)German (Dvorak)German (E1)German (E2)German (KOY)German (Ladin)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo, QWERTY)German (Neo, QWERTZ)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (T3)German (US)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters, no dead keys)German, Swedish and Finnish (US)GreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHanyu Pinyin (with AltGr dead keys)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HawaiianHebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa, phonetic)Hindi (Wx)Honeywell EuroboardHungarianHungarian (QWERTY)Hungarian (QWERTY, 101-key, comma, dead keys)Hungarian (QWERTY, 101-key, comma, no dead keys)Hungarian (QWERTY, 101-key, dot, dead keys)Hungarian (QWERTY, 101-key, dot, no dead keys)Hungarian (QWERTY, 102-key, comma, dead keys)Hungarian (QWERTY, 102-key, comma, no dead keys)Hungarian (QWERTY, 102-key, dot, dead keys)Hungarian (QWERTY, 102-key, dot, no dead keys)Hungarian (QWERTZ, 101-key, comma, dead keys)Hungarian (QWERTZ, 101-key, comma, no dead keys)Hungarian (QWERTZ, 101-key, dot, dead keys)Hungarian (QWERTZ, 101-key, dot, no dead keys)Hungarian (QWERTZ, 102-key, comma, dead keys)Hungarian (QWERTZ, 102-key, comma, no dead keys)Hungarian (QWERTZ, 102-key, dot, dead keys)Hungarian (QWERTZ, 102-key, dot, no dead keys)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)IgboIndianIndic IPAIndonesian (Arab Melayu, extended phonetic)Indonesian (Arab Melayu, phonetic)Indonesian (Javanese)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (Dvorak)Italian (IBM 142)Italian (Ladin)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US)Italian (Windows)Italian (intl., with dead keys)Italian (no dead keys)JapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7, PC-compatible)Japanese (Sun Type 7, Sun-compatible)Japanese keyboard optionsKabyle (azerty layout, dead keys)Kabyle (qwerty-gb layout, dead keys)Kabyle (qwerty-us layout, dead keys)KalmykKana Lock key is lockingKannadaKannada (KaGaPa, phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 2nd levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104-key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA)LatvianLatvian (Colemak)Latvian (Colemak, with apostrophe)Latvian (Dvorak)Latvian (Dvorak, with Y)Latvian (Dvorak, with minus)Latvian (F)Latvian (Sun Type 6/7)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer Dvorak)Latvian (programmer Dvorak, with Y)Latvian (programmer Dvorak, with minus)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (Dvorak)Lithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Ratise)Lithuanian (Sun Type 6/7)Lithuanian (US)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMake Caps Lock an additional BackspaceMake Caps Lock an additional CtrlMake Caps Lock an additional EscMake Caps Lock an additional Esc, but Shift + Caps Lock is the regular Caps LockMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (UK, with AltGr overrides)Maltese (US layout with AltGr overrides)Maltese (US)Manipuri (Eeyek)MaoriMarathi (KaGaPa, phonetic)Marathi (enhanced Inscript)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu chooses 5th levelMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMmuockModi (KaGaPa phonetic)MoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian (Galik)Mongolian (Manchu Galik)Mongolian (Manchu)Mongolian (Todo Galik)Mongolian (Todo)Mongolian (Xibe)MontenegrinMontenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Cyrillic, with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Montenegrin (Latin, with guillemets)Multilingual (Canada, Sun Type 6/7)N'Ko (azerty)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Non-breaking space inputNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Windows)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrows. Num Lock off: arrows (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOld Hungarian (for ligatures)Old Solaris keycodes compatibilityOld TurkicOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Windows)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)Phone and ATM stylePolishPolish (British keyboard)Polish (Colemak)Polish (Colemak-DH)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Windows)Romanian (ergonomic Touchtype)Romanian (standard)Rupee on 4RussianRussian (Belarus)Russian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic Macintosh)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, Windows)Russian (phonetic, YAZHERTY)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamogitianSamsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa, phonetic)Sanskrit symbolsSanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic, ZE and ZHE swapped)Serbian (Cyrillic, with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Latin, with guillemets)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US)Sinhala (phonetic)SlovakSlovak (ACC layout, only accented letters)Slovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Windows)Spanish (dead tilde)Spanish (no dead keys)Special keys (Ctrl+Alt+<key>) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Sun key compatibilitySuper Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap Esc and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Dvorak, intl.)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa, phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)The "< >" keyThe "< >" key chooses 5th levelThe "< >" key chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserThe "< >" key; acts as onetime lock when pressed together with another 3rd level chooserTibetanTibetan (with ASCII numerals)To the left of "A"Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Windows)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode arrows and math operatorsUnicode arrows and math operators on default levelUnitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Windows)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to indicate modifiersUse keyboard LED to show alternative layoutUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French)Vietnamese (QĐERTY)Vietnamese (US)ViewSonic KU-306 InternetWang 724 keypad with Unicode arrows and math operatorsWang 724 keypad with Unicode arrows and math operators on default levelWin is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.31.99 d63 1 a63 1 PO-Revision-Date: 2021-01-20 21:19+0100 d72 1 a72 1 Niveau 3 de Verr. Maj.Niveau 3 de la touche Ctrl de gaucheNiveau 3 de la touche Windows de gaucheNiveau 3 de menuNiveau 3 de la touche Ctrl de droiteNiveau 3 de la touche Windows de droiteNiveau 3 de la touche « < > »A4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSymboles APL (APLX unifié)symboles APL (APL Dyalog)Symboles APL (IBM APL2)Symboles APL (Manugistics APL*PLUS II)Symboles APL (SAX, Sharp APL for Unix)Symboles APL (unifiés)Acer AirKey VAcer C300Acer Ferrari 4000Acer (portable)Ajouter du comportement standard à la touche MenuAdvance Scorpius KIAfghanAkanAlbanaisAlbanais (Plisi)Albanais (Veqilharxhi)Autorise des actions clavier à casser les captures (attention : faille de sécurité)Autorise l'enregistrement des captures et arborescences de fenêtresAlt et Meta sont sur les touches AltComportement des touches Alt et WindowsAlt est placé sur Windows droite, Super sur MenuAlt est placé sur les touches Windows (et les touches Alt habituelles)Alt échangé avec WindowsAlt+Verr. maj.Alt+CtrlAlt+Maj.Alt+EspaceAmhariqueN'importe quelle touche AltN'importe quelle touche WindowsN'importe quelle touche Windows (maintenue)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium émule Pause, Impr. écr., Arrêt défil.Apple (portable)ArabeArabe (AZERTY)Arabe (AZERTY, chiffres arabes orientaux)Arabe (Algérie)Arabe (chiffres arabes, extensions au 4e niveau)Arabe (Buckwalter)Arabe (chiffres arabes orientaux)Arabe (chiffres arabes orientaux, extensions au 4e niveau)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (QWERTY)Arabe (QWERTY, chiffres arabes orientaux)Arabe (Sun type 6/7)Arabe (Syrie)ArménienArménien (OLPC, phonétique)Arménien (variante orientale)Arménien (variante phonétique)Arménien (orientale)Arménien (phonétique)Arménien (occidentale)Asturien (Espagne, avec H et L point bas)Asus (portable)En bas à gaucheÀ la touche correspondante sur une disposition Colemak.À la touche correspondante sur une disposition Dvorak.À la touche correspondante d'une disposition QWERTY.AtsinaAvatimeAvestiqueAzériAzéri (cyrillique)Azona RF2300 clavier internet sans filBTC 5090BTC 5113RF multimédiaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarre oblique inverseLa barre oblique inverse, avec un autre sélecteur de niveau 3, verrouille une fois ce niveauBambaraBengaliBengali (Inde)Bengali (Inde, Inscript Baishakhi)Bengali (Inde, Baishakhi)Bengali (Inde, Bornona)Bengali (Inde, Gitanjali)Bengali (Inde, Probhat)Bengali (Probhat)BachkirBiélorusseBiélorusse (latin)Biélorusse (international)Biélorusse (obsolète)BelgeBelge (ISO, variante)Belge (variante, Latin-9 uniquement)Belge (Sun type 6/7)Belge (Wang 724 AZERTY)Belge (variante)Belge (sans touche morte)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbère (Algérie, latin)Berbère (Algérie, Tifinagh)Berbère (Maroc, variante Tifinagh)Berbère (Maroc, Tifinagh étendu phonétique)Berbère (Maroc, Tifinagh étendu)Berbère (Maroc, Tifinagh phonétique)Berbère (Maroc, Tifinagh phonétique, variante)Berbère (Maroc, Tifinagh)BosniaqueBosniaque (US)Bosniaque (US, avec digraphes bosniaques)Bosniaque (avec digraphes bosniaques)Bosniaque (avec guillemets)Les deux Alt ensembleLes deux Ctrl ensembleLes deux Maj. ensembleLes 2 touches Maj. ensemble activent Verr. maj.Les 2 touches Maj. ensemble activent le Verr. maj., la touche Maj. le désactiveLes 2 touches Maj. ensemble activent le blocage majusculeBrailleBraille (pour gaucher, pouce inversé)Braille (pour gaucher)Braille (pour droiter, pouce inversé)Braille (pour droiter)Brother InternetBulgareBulgare (amélioré)Bulgare (nouvelle phonétique)Bulgare (phonétique traditionnelle)BirmanBirman ZawgyiCameroun (AZERTY, international)Anglais (Dvorak, international)Cameroun multilingue (QWERTY, international)Canadien (international)Canadien (international, 1re partie)Canadien (international, 2e partie)Verr. maj.Verr. maj. (maintenu), Alt + Verr. maj. joue le rôle original de Verr. maj.Verr. maj. agit comme un verrouillage Maj ; Maj. l'annule temporairementVerr. maj. agit comme Maj. quand il est verrouillé ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj. comme CtrlVerr. maj. comme Ctrl, Ctrl comme HyperComportement de la touche Verr. maj.Verr. maj. est désactivéVerr. maj. (première disposition), Maj. + Verr. maj. (dernière disposition)Verr. maj. bascule le blocage majuscule (affecte toutes les touches)Verr. maj. active ou désactive la mise en majuscule usuelle des caractères alphabétiquesVerr. maj. utilise la mise en majuscule interne ; Maj. annule temporairement Verr. maj.Verr. maj. utilise la mise en majuscule interne ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj., avec un autre sélecteur de niveau 3, verrouille une fois ce niveauCatalan (Espagne, avec L point médian)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (variante)Cherry CyBo@@rd concentrateur USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony internetChicony KB-9885Chicony KU-0108Chicony KU-0108ChinoisChromebookLiturgique slaveChuvashTchouvache (latin)Classmate PCCló GaelachSalish Cœur d'AlèneCompaq Armada (portable)Compaq Easy AccessCompaq Internet (13 touches)Compaq Internet (18 touches)Compaq Internet (7 touches)Compaq Presario (portable)Compaq iPaqOptions de compatibilitéCompositionCopteCreative Desktop Wireless 7000Tatar de Crimée (Q dobroudja)Tatar de Crimée (Alt-Q turc)Tatar de Crimée (F turc)Tatar de Crimée (Q turc)CroateCroate (US)Croate (US, avec les digraphes croates)Croate (avec les digraphes croates)Croate (avec guillemets)Ctrl est placé sur Alt, Alt sur WindowsCtrl est placé sur les touches Windows (et les Ctrl habituelles)Position de CtrlCtrl+Alt+Eff. arrièreCtrl+Maj.MonnaiesTchèqueTchèque (QWERTY)Tchèque (QWERTY, Macintosh)Tchèque (QWERTY, barre oblique inverse étendue)Tchèque (Sun type 6/7)Tchèque (UCW, lettres accentuées uniquement)Tchèque (Dvorak US, support UCW)Tchèque (codage)Tchèque (programmation)Tchèque (programmation, typographie)Tchèque (typographie)Tchèque (avec la touche <\|>)Tchèque, slovaque et allemand (US)DTK2000DanoisDanois (Dvorak)Danois (Macintosh)Danois (Macintosh, sans touche morte)Danois (Sun type 6/7)Danois (Windows)Espagnol (sans touche morte)Touches du pavé numérique par défautDellDell PC 101 touchesDell Inspiron 6000/8000 (portable)Dell Latitude (portable)Dell Precision M (portable)Dell Precision M65 (portable)Dell SK-8125Dell SK-8135Dell USB MultimédiaDexxa Wireless DesktopDivehiDiamond 9801/9802NéerlandaisNéerlandais (Macintosh)Danois (Sun type 6/7)Néerlandais (standard)DzongkhaDalécarlien (Suède, avec ogonek combinatoire)Active les caractères APL superposésActive des caractères typographiques supplémentairesAnglais (3l)Anglais (3l, Chromebook)Anglais (3l, Emacs)Anglais (Australien)Anglais (Cameroun)Anglais (Canada)Anglais (Carpalx)Anglais (Carpalx, complètement optimisé)Anglais (Carpalx, complètement optimisé, Hyena au niveau 5)Anglais (Carpalx, complètement optimisé, internat., touches mortes via AltGr)Anglais (Carpalx, complètement optimisé, internat., touches mortes via AltGr, Hyena au niveau 5)Anglais (Carpalx, complètement optimisé, internat., avec touches mortes)Anglais (Carpalx, complètement optimisé, internat., avec touches mortes, Hyena au niveau 5)Anglais (Carpalx, internat., touches mortes via AltGr)Anglais (Carpalx, internat., avec touches mortes)Anglais (Colemak)Anglais (Colemak-DH)Anglais (Drix)Anglais (Dvorak)Anglais (Dvorak, variante internat.)Anglais (Dvorak, internat. avec touches mortes)Anglais (Dvorak, pour gaucher)Anglais (Dvorak pour droitier)Anglais (Ghana)Anglais (Ghana, GILLBT)Anglais (Ghana, multilingue)Anglais (Inde, avec le symbole Roupie)Anglais (Macintosh)Anglais (Mali, US, Macintosh)Anglais (Mali, US, internat.)Anglais (Nigeria)Anglais (Norman)Anglais (Afrique du Sud)Anglais (Royaume-Uni)Anglais (Royaume-Uni, Colemak)Anglais (Royaume-Uni, Colemak-DH)Anglais (Royaume-Uni, Dvorak)Anglais (Royaume-Uni, Dvorak, ponctuation britannique)Anglais (Royaume-Uni, Hyena au niveau 5)Anglais (Royaume-Uni, Macintosh)Anglais (Royaume-Uni, Macintosh, international)Anglais (Royaume-Uni, MiniGuru au niveau 5)Anglais (Royaume-Uni, Sun type 6/7)Anglais (Royaume-Uni, Yoda TEX au niveau 5)Anglais (Royaume-Uni, étendu, Windows)Anglais (Royaume-Uni, internat., avec touches mortes)Anglais (Royaume-Uni, internat., avec touches mortes, Hyena au niveau 5)Anglais (Royaume-Uni, internat., avec touches mortes, MiniGuru au niveau 5)Anglais (Royaume-Uni, internat., avec touches mortes, Yoda TEX au niveau 5)Anglais (US)Anglais (US, Hyena au niveau 5)Anglais (US, Arabe IBM 238_L)Anglais (US, MiniGuru au niveau 5)Anglais (US, Sun type 6/7)Anglais (US, symbolique)Anglais (US, Yoda TEX au niveau 5)Anglais (US, variante internat.)Anglais (US, variante internat., avec touches mortes, Hyena au niveau 5)Anglais (US, variante internat., avec touches mortes, MiniGuru au niveau 5)Anglais (US, variante internat., avec touches mortes, Yoda TEX au niveau 5)Anglais (US, Euro sur le 5)Anglais (US, international, combinatoire Unicode via AltGr)Anglais (US, international, combinatoire Unicode via AltGr , Hyena au niveau 5)Anglais (US, international, combinatoire Unicode via AltGr, MiniGuru au niveau 5)Anglais (US, international, combinatoire Unicode via AltGr, Yoda TEX au niveau 5)Anglais (US, international, combinatoire Unicode via AltGr, variante)Anglais (US, internat., avec touches mortes)Anglais (Workman)Anglais (Workman, internat., avec touches mortes)Anglais (Dvorak classique)Anglais (internat., touches mortes via AltGr)Anglais (Dvorak pour programmeur)Anglais (diviser/multiplier bascule la disposition)Ennyah DKB-1008Entrée sur le pavé numériqueEspérantoEspéranto (Brésil, Nativo)Espéranto (Portugal, PT-Nativo)Espéranto (obsolète)Lettres espéranto avec exposantsEstonienEstonien (Dvorak)Estonien (Sun type 6/7)Estonien (US)Estonien (sans touche morte)EurKEY (US)Euro sur le 2Euro sur le 4Euro sur le 5Euro sur le EEverex STEPnoteÉwéFL90FéroïenFéroïen (sans touche morte)FilipinoFilipino (Capewell-Dvorak, baybayin)Filipino (Capewell-Dvorak, latin)Filipino (Capewell-QWERF 2006, baybayin)Filipino (Capewell-QWERF 2006, latin)Filipino (Colemak, baybayin)Filipino (Colemak, latin)Filipino (Dvorak, baybayin)Filipino (Dvorak, latin)Filipino (QWERTY, baybayin)FinnoisFinnois (DAS)Finnois (Dvorak)Finnois (Macintosh)Finnois (Sun type 6/7)Finnois (Windows)Finnois (classique)Finnois (classique, sans touche morte)Touche à quatre niveaux avec le séparateur décimal abstraitTouche à quatre niveaux avec virguleTouche à quatre niveaux avec pointTouche à quatre niveaux avec point, Latin-9 uniquementTouche à quatre niveaux avec le séparateur décimal momayyezFrançaisFrançais (AZERTY)Français (AZERTY, AFNOR)Français (BÉPO)Français (BÉPO, AFNOR)Français (BÉPO, Latin-9 uniquement)Français (breton)Français (Cameroun)Français (Canada)Français (Canada, Dvorak)Français (Canada, obsolète)Français (République démocratique du Congo)Français (Dvorak)Français (Macintosh)Français (Mali, variante)Français (Maroc)Français (Sun type 6/7)Français (Suisse)Français (Suisse, Macintosh)Français (Suisse, Sun type 6/7)Français (Suisse, sans touche morte)Français (Togo)Français (US avec touches mortes, variante)Français (US)Français (US, AZERTY)Français (variante)Français (variante, Latin-9 uniquement)Français (variante, sans touche morte)Français (obsolète, variante)Français (obsolète, variante, sans touche morte)Français (sans touche morte)Frioulan (Italie)Fujitsu-Siemens Amilo (portable)PeulGaPC générique 101 touchesPC générique 102 touchesPC générique 104 touchesPC générique 104 touches avec touche Entrée en LPC générique 105 touchesPC générique 86 touchesGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGéorgienGéorgien (France, AZERTY Tskapo)Géorgien (Italie)Géorgien (MESS)Géorgien (ergonomique)AllemandAllemand (Aus der Neo-Welt)Allemand (Autriche)Allemand (Autriche, Macintosh)Allemand (Autriche, sans touche morte)Allemand (Bone)Allemand (Bone, ß dans la rangée du milieu)Allemand (Dvorak)Allemand (E1)Allemand (E2)Allemand (KOY)Allemand (Ladin)Allemand (Macintosh)Allemand (Macintosh, sans touche morte)Allemand (Neo 2)Allemand (Neo, QWERTY)Allemand (Neo, QWERTZ)Allemand (QWERTY)Allemand (Sun type 6/7)Allemand (Suisse)Allemand (Suisse, Macintosh)Allemand (Suisse, Sun type 6/7)Allemand (Suisse, obsolète)Allemand (Suisse, sans touche morte)Allemand (T3)Allemand (US)Allemand (accent aigu en touche morte)Allemand (accents aigu et grave en touches mortes)Allemand (tilde en touche morte)Allemand (sans touche morte)Allemand (avec lettres hongroises, sans touche morte)Allemand, suédois et finnois (US)GrecGrec (Colemak)Grec (Sun type 6/7)Grec (étendu)Grec (sans touche morte)Grec (polytonique)Grec (simple)GujarâtîGyrationHanyu Pinyin (touches mortes via AltGr)Happy HackingHappy Hacking pour MacHaoussa (Ghana)Haoussa (Nigeria)HawaïenHébreuHébreu (biblique, SIL, phonétique)Hébreu (biblique, Tiro)Hébreu (lyx)Hébreu (phonétique)Hewlett-Packard InternetHewlett-Packard Mini 110 (portable)Hewlett-Packard NEC SK-2500 MultimédiaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadécimalHindi (bolnagri)Hindi (KaGaPa, phonétique)Hindi (Wx)Honeywell EuroboardHongroisHongrois (QWERTY)Hongrois (QWERTY, 101 touches, virgule, touches mortes)Hongrois (QWERTY, 101 touches, virgule, sans touche morte)Hongrois (QWERTY, 101 touches, point, touches mortes)Hongrois (QWERTY, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (QWERTZ, 101 touches, virgule, touches mortes)Hongrois (QWERTZ, 101 touches, virgule, sans touche morte)Hongrois (QWERTZ, 101 touches, point, touches mortes)Hongrois (QWERTZ, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (sans touche morte)Hongrois (standard)Hyper est placé sur les touches WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandaisIslandais (Dvorak)Islandais (Macintosh)Islandais (Macintosh, obsolète)IgboIndienIndic IPAIndonésien (Arabe Malayu, phonétique étendu)Indonésien (Arabe Malayu, phonétique)Indonésien (Javanais)Alphabet phonétique internationalInuktitutIrakienIrlandaisIrlandais (UnicodeExpert)ItalienItalien (Dvorak)Italien (IBM 142)Italien (Ladin)Italien (Macintosh)Italien (Sun type 6/7)Italien (US)Italien (Windows)Italien (internat., avec touches mortes)Italien (sans touche morte)JaponaisJaponais (Dvorak)Japonais (Kana 86)Japonais (Kana)Japonais (Macintosh)Japonais (OADG 109A)Japonais (PC-98)Japonais (Sun type 6)Japonais (Sun type 7, compatible PC)Japonais (Sun type 7, compatible Sun)Options des claviers japonaisKabyle (azerty, touches mortes)Kabyle (qwerty anglais, touches mortes)Kabyle (qwerty US, touches mortes)KalmykLa touche « verrouillage Kana » verrouilleKannadaKannada (KaGaPa, phonétique)CachoubeKazakhKazakh (latin)Kazakh (étendu)Kazakh (avec russe)Séquence de touches pour tuer le serveur XTouche sélectionnant le niveau 5Touche sélectionnant le niveau 2Touche sélectionnant le niveau 3Keytronic FlexProKhmer (Cambodge)KikuyuKinesisKomiCoréenCoréen (compatible 101/104 touches)Coréen (Sun type 6/7)Touches Hangeul/Hanja coréennesKurde (Iran, arabe-latin)Kurde (Iran, F)Kurde (Iran, Alt-Q latin)Kurde (Iran, Q latin)Kurde (Irak, arabe-latin)Kurde (Irak, F)Kurde (Irak, Alt-Q latin)Kurde (Irak, Q latin)Kurde (Syrie, F)Kurde (Syrie, Alt-Q latin)Kurde (Syrie, Q latin)Kurde (Turquie, F)Kurde (Turquie, Alt-Q latin)Kurde (Turquie, Q latin)KutenaiKirghizeKirghize (phonétique)LaoLao (STEA)LettonLetton (Colemak)Letton (Colemak, avec apostrophe)Letton (Dvorak)Letton (Dvorak, avec Y)Letton (Dvorak, avec moins)Letton (F)Letton (Sun type 6/7)Letton (adapté)Letton (apostrophe)Letton (ergonomique, ŪGJRMV)Letton (moderne)Letton (Dvorak pour le programmeur)Letton (Dvorak pour le programmeur, avec Y)Letton (Dvorak pour le programmeur, avec moins)Letton (tilde)Disposition du pavé numériqueAlt gaucheAlt gauche (maintenu)Alt. gauche pour Ctrl, Ctrl pour Win, Win gauche pour Alt. gaucheAlt gauche échangé avec Windows gaucheAlt gauche+Maj. gaucheCtrl gaucheCtrl gauche comme MétaCtrl gauche (première disposition), Ctrl droit (dernière disposition)Ctrl gauche+Maj. gaucheCtrl gauche + Windows gaucheCtrl gauche + Windows gauche (première disposition), Ctrl droit + Menu (seconde disposition)Maj. gaucheTouche Windows gaucheWindows gauche (maintenu)Windows gauche sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauTouche Windows gauche (première disposition), touche Windows droite (dernière disposition)ObsolèteWang 724 (obsolète)Touche obsolète avec virguleTouche obsolète avec pointLituanienLituanien (Dvorak)Lituanien (IBM LST 1205-92)Lituanien (LEKP)Lituanien (LEKPa)Lituanien (Ratise)Lituanien (Sun type 6/7)Lituanien (US)Lituanien (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (variante)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (variante 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTouches supplémentaires Logitech G15 via le démon G15Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bas-sorabeBas-sorabe (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (Internat.)MacédonienMacédonien (sans touche morte)MacintoshMacintosh (ancien)Faire de Verr. maj. un Effacement. arrière supplémentaire.Faire de Verr. maj. un Ctrl supplémentaire.Faire de Verr. maj. un Échap. supplémentaire.Faire de Verr. maj. un Échap. supplémentaire, mais Maj. + Verr. maj. a l'effet du Verr. maj. habituelFaire de Verr. maj. un Hyper supplémentaireFaire de Verr. maj. une touche Menu supplémentaire.Faire de Verr. maj. un Verr. Num. supplémentaireFaire de Verr. maj. un Super supplémentaire.Faire du Zenkaku Hankaku un Échap. supplémentaire.Alt. droite comme touche hangeulAlt. droite comme touche hanjaCtrl. droite comme touche hangeulCtrl. droite comme touche hanjaMalais (clavier jawi, arabe)Malais (jawi, phonétique)MalayâlamMalayâlam (lalitha)Malayâlam (Inscript amélioré avec le roupie)MaltaisMaltais (disposition anglaise avec des surcharges via AltGr)Maltais (disposition US avec des surcharges via AltGr)Maltais (US)Meitei (Eeyek)MaoriMarathe (KaGaPa, phonétique)Marathe (Inscript amélioré)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (maintenu), Maj.+Menu pour MenuMenu comme Ctrl droiteMenu sélectionne le niveau 5Menu est placé sur les touches WindowsMéta est placé sur Windows gaucheMéta est placé sur les touches WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (suédois)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB /Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Clavier Microsoft OfficeMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AM'mockModi (phonétique KaGaPa)MoldaveMoldave (Gagaouze)MongolMongol (bichig)Mongol (galik)Mongol (galik mandchou)Mongol (mandchou)Mongol (galik todo)Mongol (todo)Mongol (xibe)MonténégrinMonténégrin (cyrillique)Monténégrin (cyrillique, ZE et ZHE intervertis)Monténégrin (cyrillique, avec guillemets)Monténégrin (latin, QWERTY)Monténégrin (latin, Unicode)Monténégrin (latin, Unicode, QWERTY)Monténégrin (latin, avec guillemets)Multilingue (Canada, Sun type 6/7)N'ko (azerty)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Eff. Arr. du type NICOLA-FNépalaisEspace insécable au niveau 2Espace insécable au niveau 3Espace insécable au niveau 3, rien au niveau 4Espace insécable au niveau 3, espace fine insécable au niveau 4Espace insécable au niveau 4Espace insécable au niveau 4, espace fine insécable au niveau 6Espace insécable au niveau 4, espace fine insécable au niveau 6 (via Ctrl+Maj.)Entrée d'une espace insécableSami du Nord (Finlande)Sami du Nord (Norvège)Sami du Nord (Norvège, sans touche morte)Sami du Nord (Suède)Northgate OmniKey 101NorvégienNorvégien (Colemak)Norvégien (Dvorak)Norvégien (Macintosh)Norvégien (Macintosh, sans touche morte)Norvégien (Sun type 6/7)Norvégien (Windows)Norvégien (sans touche morte)Verr. Num.Verr. num. activé : chiffres ; maj. pour les flèches. Verr. num. désactivé : flèches (comme Windows)Touche numérique 4 pour un appui isoléTouche numérique 9 pour un appui isoléComportement de la touche de Suppr. du pavé numériqueLes touches du pavé numérique sont toujours numériques (comme sur Mac OS)OLPCOccitanOghamOgham (IS434)SantaliRunes HongroisesAncien hongrois (pour les ligatures)Compatibilité avec les anciens codes des touches SolarisTurc ancienOriyaOrtek MCK-800 Multimédia/InternetOssète (Géorgie)Ossète (Windows)Ossète (obsolète)PC-98Ruthène pannonienPosition des parenthèsesPachtoPachto (Afghanistan, OLPC)PausePersanPersan (Afghanistan, Dari, OLPC)Persan (avec pavé numérique persan)Type DAB ou téléphonePolonaisPolonais (clavier anglais)Polonais (Colemak)Polonais (Colemak-DH)Polonais (Dvorak)Polonais (Dvorak, guillemets polonais sur le 1)Polonais (Dvorak, guillemets polonais sur la touche guillemets)Polonais (Allemagne, sans touche morte)Polonais (glagolitique)Polonais (QWERTZ)Polonais (Sun type 6/7)Polonais (internat., avec touches mortes)Polonais (obsolète)Polonais (Dvorak pour le programmeur)PortugaisPortugais (Brésil)Portugais (Brésil, Dvorak)Portugais (Brésil, ThinkPad IBM/Lenovo)Portugais (Brésil, Nativo pour claviers US)Portugais (Brésil, Nativo)Portugais (Brésil, Sun type 6/7)Portugais (Brésil, sans touche morte)Portugais (Colemak)Portugais (Macintosh)Portugais (Macintosh, sans touche morte)Portugais (Nativo pour claviers US)Portugais (PT-Nativo)Portugais (Sun type 6/7)Portugais (sans touche morte)Position de la touche ComposePropeller Voyager KTEZ-1000Impr. Écr.Penjabi (Gurmukhî, Jhelum)Penjabi (Gurmukhî)QTronix Scorpius 98N+Alt droiteAlt droite (maintenu)Alt droite sélectionne le niveau 5Alt. droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauAlt droite ne sélectionne jamais le niveau 3Alt droite, Maj. + Alt droite est la touche composeCtrl droiteCtrl droite (maintenu)Ctrl droite comme Alt droiteCtrl droite + Maj. droiteMaj. droiteWindows droiteWindows droite (maintenu)Windows droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauRoumainRoumain (Allemagne)Roumain (Allemagne, sans touche morte)Roumain (Sun type 6/7)Roumain (Windows)Roumain (ergonomique dactylographique)Roumain (standard)Roupie sur le 4RusseRusse (Biélorusse)Russe (Tchèque, phonétique)Russe (DOS)Russe (Géorgie)Russe (Allemagne, phonétique)Russe (Allemagne, recommandé)Russe (Allemagne, translittération)Russe (Kazakhstan, avec kazakh)Russe (Macintosh)Russe (Pologne, Dvorak phonétique)Russe (polyglotte et réactionnaire)Russe (Rulemak, Colemak phonétique)Russe (Sun type 6/7)Russe (Suède, phonétique)Russe (Suède, phonétique, sans touche morte)Russe (US, phonétique)Russe (Ukraine, RSTU standard)Russe (obsolète)Russe (Macintosh phonétique)Russe (phonétique)Russe (phonétique, AZERTY)Russe (phonétique, Dvorak)Russe (phonétique, français)Russe (phonétique, Windows)Russe (phonétique, YAZHERTY)Russe (machine à écrire)Russe (machine à écrire, obsolète)Russe (avec ponctuation US)Russe (Ukrainien-Biélorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taïwan)SamogitienSamsung SDM 4500PSamsung SDM 4510PSanscrit (KaGaPa, phonétique)Symboles sanscritSanwa Supply SKB-KG3Arrêt défilementSecwepemctsinPoint-virgule au niveau 3SerbeSerbe (cyrillique, ZE et ZHE intervertis)Serbe (cyrillique, avec guillemets)Serbe (Latin)Serbe (Latin, QWERTY)Serbe (latin, Unicode)Serbe (latin, Unicode, QWERTY)Serbe (Latin, avec guillemets)Serbe (Russe)Serbe (accents combinatoires à la place des touches mortes)Serbo-Croate (US)Maj. + VerrNum bascule le contrôle souris au clavier (PointerKeys) Maj. annule Verr. maj.Maj. n'annule pas Verr. num., mais sélectionne le niveau 3Maj.+ Verr. maj.SicilienSicilien (clavier US)SilésienSilvercrest Multimedia WirelessSindhîCingalais (US)Cingalais (phonétique)SlovaqueSlovaque (disposition ACC, lettres accentuées uniquement)Slovaque (QWERTY)Slovaque (QWERTY, barre oblique inverse étendue)Slovaque (Sun type 6/7)Slovaque (barre oblique inverse étendue)SlovèneSlovène (US)Slovène (avec guillemets)EspagnolEspagnol (Dvorak)Espagnol (Amérique latine)Espagnol (Amérique latine, Colemak spécial jeux)Espagnol (Amérique latine, Colemak)Espagnol (Amérique latine, Dvorak)Espagnol (Amérique latine, tilde en touche morte)Espagnol (Amérique latine, sans touche morte)Espagnol (Macintosh)Espagnol (Sun type 6/7)Espagnol (Windows)Espagnol (tilde en touche morte)Espagnol (sans touche morte)Les combinaisons spéciales (Ctrl+Alt+<touche>) sont traitées par le serveur XSteelSeries Apex 300 (Apex RAW)Sun type 6 (Japon)Sun type 6 USB (Japon)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europe)Sun type 7 USBSun type 7 USB (Europe)Sun type 7 USB (Japon)/Japonais 106 touchesSun type 7 USB (Unix)Compatibilité avec les touches SunSuper Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Intervertir Ctrl et Verr. maj.Intervertir Échap. et Verr. maj.Échange Alt. gauche et Ctrl gaucheÉchange Win gauche et Ctrl gaucheÉchange Win droite et Ctrl droiteÉchangé avec les crochetsSuédoisSuédois (Dvorak A5)Suédois (Dvorak)Suédois (Dvorak, international)Suédois (Macintosh)Suédois (Sun type 6/7)Suédois (Svdvorak)Suédois (US)Suédois (sans touche morte)Langue des signes suédoisePassage à une autre dispositionSymplon PaceBook (tablette)SyriaqueSyriaque (phonétique)TaïwanaisTaïwanais (indigène)TadjikTadjik (obsolète)Tamoul (Inscript)Tamoul (Sri Lanka, TamilNet '99)Tamoul (Sri Lanka, TamilNet '99, codage TAB)Tamoul (TamilNet '99 avec chiffres tamouls)Tamoul (TamilNet '99)Tamoul (TamilNet '99, codage TAB)Tamoul (TamilNet '99, codage TSCII)Targa Visionary 811TatarTélougouTélougou (KaGaPa, phonétique)Télougou (Sarala)ThaïThaï (Pattachote)Thaï (TIS-820.2538)La touche « < > »La touche « < > » sélectionne le niveau 5La touche « < > » sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauLa touche « < > », avec un autre sélecteur de niveau 3, verrouille une fois ce niveauTibétainTibétain (avec chiffres ASCII)À gauche du « A »Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Allemagne)Turc (Sun type 6/7)Turc (internat., avec touches mortes)TurkmèneTurkmène (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)OudmourteOugaritique à la place de l'arabeUkrainienUkrainien (Sun type 6/7)Ukrainien (Windows)Ukrainien (homophonique)Ukrainien (obsolète)Ukrainien (phonétique)Ukrainien (RSTU standard)Ukrainien (machine à écrire)Opérateurs mathématiques et flèches UnicodeOpérateurs mathématiques et flèches Unicode au niveau par défautUnitek KB-1925Ourdou (Pakistan)Ourdou (Pakistan, CRULP)Ourdou (Pakistan, NLA)Ourdou (Windows)Ourdou (variante phonétique)Ourdou (phonétique)Utiliser les LED clavier pour indiquer les modificateursUtiliser les LED clavier pour indiquer une disposition alternativeL'espace habituelle quel que soit le niveauOuïghourOuzbekOuzbek (Afghanistan)Ouzbek (Afghanistan, OLPC)Ouzbek (latin)VietnamienVietnamien (AÐERTY)Vietnamien (français)Vietnamien (QĐERTY)Vietnamien (US)ViewSonic KU-306 InternetPavé Wang 724 avec opérateurs mathématiques et flèches UnicodePavé Wang 724 avec opérateurs mathématiques et flèches Unicode au niveau par défautLa touche Windows est placé sur Impr. écr. (en plus de la touche Windows)Windows+EspaceWinbook Model XP5WolofYahoo! InternetIakuteYorubaAntiliant sans chasse au niveau 2Antiliant sans chasse au niveau 2. espace insécable au niveau 3Antiliant sans chasse au niveau 2, espace insécable au niveau 3, rien au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, espace fine insécable au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, liant sans chasse au niveau 4Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3, espace insécable au niveau 4Antiliant sans chasse au niveau 3, liant sans chasse au niveau 4akamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 (portable)eeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh@ 1.1.1.5 log @initial import of xkeyboard-config-2.33 @ text @d1 62 a62 62 %MKdddde'e?e Vewe e eeeeef%f%Cfif f ff f%fffffggC-g"qggg)g&gh *h8h Ah KhUh]hehmhhhhh2h iii(%iNi5_ii i=ijj ,j:jLj(\jjjjjjjjk%k)8k bknk,k+k+kl ll l)l@@l_lhl ~l ll l l l+l lTlGmOmVm"emmmmmm m nn&n9nMnUninnnnn nnn o$o?o,_o#o#o)oop !p#.pRprpppp$p?p%*qPq$Xq}q%qqq qqr r:rBrQrjr%rrrr rJr>EsEss sst9&t/`t@@t@@tGuTZu"uuuuv'v>vUvrvvvvvv vvvv w w$w9wNwaw{www wwwwwx/xMxgxx x%x!xx!x.y(Ly uyy yyyyy"yz"z:z Zzhz |zzzz@@z+{3{:{J{ ]{~{{{{{{{ | |8| R| _|l||||||| |||*}.}#L} p}}}}}}}}$}A~;\~.~(~~0?P'm4Hf ǀ݀) 5Ml# ˁ؁)B,Z2#ނ(%2X/t ă΃#=FX p~ ʄڄބ$ !0(R%{؅ ) 1?Pd{'%?\cs ɇه)+UexȈ"" . < ]i }É#ى$AFI\o*Ҋ& (9K Tű݋ %&L \ h t Čӌ #8"X{" ǍӍ-+ Yzˎݎ# "0 FTdmt ˏ&+H"hː ( ?K\ u -0ߑ+.<-k0+ʒ.-%0S+.-ߓ0 +>.jǔޔ3 P q{•Ǖ Ε*ؕ, LV\bxǖ ޖ4=Obr$×%(#H#l Әݘ!=Uqę˙7Ie}Ț)=[u} " )5L^!sÜ#ߜ'+;T]8v!ѝ 46KD^ `О71ip ɟ 9I_hx  Ӡ#!(: c+%֡'+Scx%)͢ 0 LW q {&! ңP"D%g%"&֤4Qm )" ""EV\wϦ)Ԧ(>Yo ҧ  &%"L)o"Ũ  #-@@Rk~ é*ک'-I$f$# Ԫ +#2#V=zM#M*^x׬ %!G_ u# &K/&{&ɮ1' -; DR"p  ! ".4DY`{ Ȱܰ",24_Ʊֱ  6AU(q,Dz!!'<$S$x˳9L bla!%& LWr aѵ3< Op ζٶ -I"h!!"#*A(\ θ4Ok+ع & 8CUg úܺ&# /?W p 0û$-9Eؼ ߼*1#Ae{ ̽Խ,!+ M$n&ξ 7#[{ҿ*BXn0JRfw #;B T^u{-("'$Jo%k^#;Ocw )B_.|* /FYn!2*?Nc&s+  (3H\q6G( CM_eu{&Keu[oJAoJGJMQV\adhlorvy|  #'*-07:=@@DGJMPSVZ]`cfilorux{~   $'(P$a''*  ;?[u&&  2-`t{WD $N's1G0?H Q \f+9Qbh)w0!:S e s)  4Uk)875W &   ' 1 <+Fr^")C[u $<Qiz #. "O&r0 )%(Nj/P9/i&q&$:_ f t,$# DLOIZA'W$MD [RXVO^'# /Pg  " /<Rk~  !'Fe '#(/<XA  -1J|.!%6$M#rJ%9O`'}" 4 ANcz /&26Y *P@@K61FXq$/9Ia&~1G!f6 /#.'R5z  0;LE,1 ?-Z!3  6W!n    $2BH MWu$~!(%1Kg &>;%z#7> ;EXr%.7fy %'M,^('27j 3Hc}& !"5F^g&- - ;IXi'~!>^${  &2 75T"  )'2 Zh$ #-'Qy"9Yv  7:95t87:5V87:588n7:58P(  8  U  v       0  ( "<  _ i  q {         ( C _ h z      $ % 9 $W 1| (  .   3 < C R c +w ! ! !  ,3;@@$Hm )CYj  #!4Vf~ 10#A+e/ A(S| G]4 n\=  ,=Ob{$ #8!\*~ +7.@@Vr'%+% Q\p  <,*/Wg,41Q-4 !&Hh /+ $"1Tci$ "'@@#h(! 1R'l")" /6PXkr   1 +F r  & & "  ! .! :! F! R!^! y!!!/!A!1"AO"Q""##*3#^#t# ####)##$.$ M$lX$($($7%LO%%%% %%%$%9% 5&A&G& X&"c&&&& &&&&&''2'8' ?'%`'''''''/'?-('m(((()()%) <)F)Z)(v),))!)& *1*E*([*#*****+ /+;+W+k+ ++#+k+-2,3`, ,,,, ,, -n$---&---&-&.9.I.O.c. ....$./!/#3/$W/$|///./0080J0h0|000001%)1O1k11 11 1111 2232 F2T2n2)t2#2 22223 ;3<I33D33;304A4J4 `4j44444:4415A5)Y55 5555525$6#D62h6.6666 7+7UH7777778)888+P8|8#88888!9#19"U9"x99999 9::5: I:W:t: :::: ::;;); ;;,\;+;;!;#;<%< +<5<U<h<n<<<4<{<ac= ===>>2>F>Z>i>>> >>>>%> >> ?"???.\?*? ?"? ??@@@@3@@I@@a@@{@@.@@D@@AA/AHA_ApAA8ABA+B KBUB\BqBB BBBBBBBCYTCKCC DD!D1D8D!?D@@aDRDdD_ZE@@E_E@@[FFFFFFFFFFFFFFFFFFFFFFFF FFGG GGGG/G2G5G8G;G>GAGDGGGJGMGPGVGZG^GaGdGgGkGnGqGtGwGzG}GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG GGGHHH H HHHHHH!H$H(H+H.H1H4H7H:H=HAHDHGHJHMHPHSHVHZH]H`HcHfHiHlHoHsHvHyH|,wQQ.g&q jU w{- xBM;zDaH;IVdpN~"7c(UR<#C[Y\]?8Z_llT7`$RGgJ5D:jk[@@LAp_3qU68ewu[xyAo0rL%XB   <E zHMW<Oh^y#F*Mxcqd= S,9@@O|Si!mV9b&\GnXt$ar DD;?)Mv^> {/n>M~.|%%mh9 6*Pq$f?V6--&Zj[ #2n]:i8'\`f% >i0;'x%^=La&Kc}0J -zahu Gr"eeTCJz3Y.yzC:}o*J('~Z^=EqevWC!+Pg3IYv~X@@wG5<m*d)A`jySA=:6411u4?Rk=+@@Y7)nDsSKs5UN\8rlH s-3427"1h')0t &bn5k1pvN"K9/"oo/{!LEmU fSTVg oBJ`>I/2V6si3FkEpP2ra@@AfNe,.b!*K]:sfx C]/T(B10.Lwdh7W]Q(  E}Wl2+tt;+W>R_(+b,O_ `4cv } NOPYk?<!FjH85#mTGu|[By{KFZ4~$d#O 9X,bgQiIIXP}lc ) {p H|FZu^tR_'\Q$ 3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right Win3rd level of the "< >" keyA user-defined custom LayoutA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL symbols (APLX unified)APL symbols (Dyalog APL)APL symbols (IBM APL2)APL symbols (Manugistics APL*PLUS II)APL symbols (SAX, Sharp APL for Unix)APL symbols (unified)Acer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Albanian (Veqilharxhi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt and Win behaviorAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium emulates Pause, PrtSc, Scroll LockApple laptopArabicArabic (AZERTY)Arabic (AZERTY, Eastern Arabic numerals)Arabic (Algeria)Arabic (Arabic numerals, extensions in the 4th level)Arabic (Buckwalter)Arabic (Eastern Arabic numerals)Arabic (Eastern Arabic numerals, extensions in the 4th level)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (QWERTY, Eastern Arabic numerals)Arabic (Sun Type 6/7)Arabic (Syria)ArmenianArmenian (OLPC, phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and L)Asus laptopAt the bottom leftAt the corresponding key in a Colemak layoutAt the corresponding key in a Dvorak layoutAt the corresponding key in a QWERTY layoutAtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 Wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi InScript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Gitanjali)Bangla (India, Probhat)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (intl.)Belarusian (legacy)BelgianBelgian (ISO, alt.)Belgian (Latin-9 only, alt.)Belgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt.)Belgian (no dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh phonetic, alt.)Berber (Morocco, Tifinagh)BosnianBosnian (US)Bosnian (US, with Bosnian digraphs)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (enhanced)Bulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon (AZERTY, intl.)Cameroon (Dvorak, intl.)Cameroon Multilingual (QWERTY, intl.)Canadian (intl.)Canadian (intl., 1st part)Canadian (intl., 2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock as Ctrl, Ctrl as HyperCaps Lock behaviorCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles Shift Lock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (alt.)Cherry CyBo@@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCompatibility optionsComposeCopticCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US)Croatian (US, with Croatian digraphs)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt, Alt to WinCtrl is mapped to Right Win and the usual CtrlCtrl is mapped to Win and the usual CtrlCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCurrency signsCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with <\|> key)Czech Slovak and German (US)Czech, Slovak, Polish, Spanish, Finnish, Swedish and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Windows)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (US)Dutch (standard)DzongkhaElfdalian (Swedish, with combining ogonek)Enable APL overlay charactersEnable extra typographic charactersEnglish (3l)English (3l, Chromebook)English (3l, emacs)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Colemak-DH ISO)English (Colemak-DH)English (Drix)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Colemak-DH)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Macintosh, intl.)English (UK, Sun Type 6/7)English (UK, extended, Windows)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, Symbolic)English (US, alt. intl.)English (US, euro on 5)English (US, intl., AltGr Unicode combining)English (US, intl., AltGr Unicode combining, alt.)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (legacy)Esperanto letters with superscriptsEstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US)Estonian (no dead keys)EurKEY (US)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Dvorak)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Windows)Finnish (classic)Finnish (classic, no dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (AZERTY, AFNOR)French (BEPO)French (BEPO, AFNOR)French (BEPO, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Togo)French (US with dead keys, alt.)French (US)French (US, AZERTY)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (no dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PCGeneric 104-key PCGeneric 104-key PC with L-shaped Enter keyGeneric 105-key PCGeneric 86-key PCGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Bone)German (Bone, eszett in the home row)German (Dvorak)German (E1)German (E2)German (KOY)German (Ladin)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo, QWERTY)German (Neo, QWERTZ)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (T3)German (US)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters, no dead keys)German, Swedish and Finnish (US)GreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHanyu Pinyin (with AltGr dead keys)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HawaiianHebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa, phonetic)Hindi (Wx)Honeywell EuroboardHungarianHungarian (QWERTY)Hungarian (QWERTY, 101-key, comma, dead keys)Hungarian (QWERTY, 101-key, comma, no dead keys)Hungarian (QWERTY, 101-key, dot, dead keys)Hungarian (QWERTY, 101-key, dot, no dead keys)Hungarian (QWERTY, 102-key, comma, dead keys)Hungarian (QWERTY, 102-key, comma, no dead keys)Hungarian (QWERTY, 102-key, dot, dead keys)Hungarian (QWERTY, 102-key, dot, no dead keys)Hungarian (QWERTZ, 101-key, comma, dead keys)Hungarian (QWERTZ, 101-key, comma, no dead keys)Hungarian (QWERTZ, 101-key, dot, dead keys)Hungarian (QWERTZ, 101-key, dot, no dead keys)Hungarian (QWERTZ, 102-key, comma, dead keys)Hungarian (QWERTZ, 102-key, comma, no dead keys)Hungarian (QWERTZ, 102-key, dot, dead keys)Hungarian (QWERTZ, 102-key, dot, no dead keys)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)IgboIndianIndic IPAIndonesian (Arab Pegon, extended phonetic)Indonesian (Javanese)Indonesian (Latin)International Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (Dvorak)Italian (IBM 142)Italian (Ladin)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US)Italian (Windows)Italian (intl., with dead keys)Italian (no dead keys)JapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7, PC-compatible)Japanese (Sun Type 7, Sun-compatible)Japanese keyboard optionsKabyle (AZERTY, with dead keys)Kabyle (QWERTY, UK, with dead keys)Kabyle (QWERTY, US, with dead keys)KalmykKana Lock key is lockingKannadaKannada (KaGaPa, phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 2nd levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104-key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA)LatvianLatvian (Colemak)Latvian (Colemak, with apostrophe)Latvian (Dvorak)Latvian (Dvorak, with Y)Latvian (Dvorak, with minus)Latvian (F)Latvian (Sun Type 6/7)Latvian (adapted)Latvian (apostrophe)Latvian (apostrophe, dead quotes)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer Dvorak)Latvian (programmer Dvorak, with Y)Latvian (programmer Dvorak, with minus)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (Dvorak)Lithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Ratise)Lithuanian (Sun Type 6/7)Lithuanian (US)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMake Caps Lock an additional BackspaceMake Caps Lock an additional CtrlMake Caps Lock an additional EscMake Caps Lock an additional Esc, but Shift + Caps Lock is the regular Caps LockMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced InScript, with rupee)MalteseMaltese (UK, with AltGr overrides)Maltese (US)Maltese (US, with AltGr overrides)Manipuri (Eeyek)MaoriMarathi (KaGaPa, phonetic)Marathi (enhanced InScript)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu chooses 5th levelMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMmuockModi (KaGaPa phonetic)MoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian (Galik)Mongolian (Manchu Galik)Mongolian (Manchu)Mongolian (Todo Galik)Mongolian (Todo)Mongolian (Xibe)MontenegrinMontenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Cyrillic, with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Montenegrin (Latin, with guillemets)Multilingual (Canada, Sun Type 6/7)N'Ko (AZERTY)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Non-breaking space inputNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Windows)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrows. Num Lock off: arrows (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOld Hungarian (for ligatures)Old Solaris keycodes compatibilityOld TurkicOriyaOriya (Bolnagri)Oriya (Wx)Ortek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Windows)Ossetian (legacy)OttomanOttoman (F)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)Phone and ATM stylePolishPolish (British keyboard)Polish (Colemak)Polish (Colemak-DH)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Windows)Romanian (ergonomic Touchtype)Romanian (standard)Rupee on 4RussianRussian (Belarus)Russian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic Macintosh)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, Windows)Russian (phonetic, YAZHERTY)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamogitianSamsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa, phonetic)Sanskrit symbolsSanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic, ZE and ZHE swapped)Serbian (Cyrillic, with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Latin, with guillemets)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US)Sinhala (phonetic)SlovakSlovak (ACC layout, only accented letters)Slovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Windows)Spanish (dead tilde)Spanish (no dead keys)Special keys (Ctrl+Alt+<key>) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Sun key compatibilitySuper Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap Esc and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Dvorak, intl.)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (InScript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa, phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)The "< >" keyThe "< >" key chooses 5th levelThe "< >" key chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserThe "< >" key; acts as onetime lock when pressed together with another 3rd level chooserTibetanTibetan (with ASCII numerals)To the left of "A"Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Windows)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode arrows and math operatorsUnicode arrows and math operators on default levelUnitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Windows)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to indicate modifiersUse keyboard LED to show alternative layoutUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French)Vietnamese (QĐERTY)Vietnamese (US)ViewSonic KU-306 InternetWang 724 keypad with Unicode arrows and math operatorsWang 724 keypad with Unicode arrows and math operators on default levelWin is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcscustomdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.32.99 d64 1 a64 1 PO-Revision-Date: 2021-05-22 13:09+0200 d73 1 a73 1 Niveau 3 de Verr. Maj.Niveau 3 de la touche Ctrl de gaucheNiveau 3 de la touche Windows de gaucheNiveau 3 de menuNiveau 3 de la touche Ctrl de droiteNiveau 3 de la touche Windows de droiteNiveau 3 de la touche « < > »Une disposition définie par l'utilisateurA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSymboles APL (APLX unifié)symboles APL (APL Dyalog)Symboles APL (IBM APL2)Symboles APL (Manugistics APL*PLUS II)Symboles APL (SAX, Sharp APL for Unix)Symboles APL (unifiés)Acer AirKey VAcer C300Acer Ferrari 4000Acer (portable)Ajouter du comportement standard à la touche MenuAdvance Scorpius KIAfghanAkanAlbanaisAlbanais (Plisi)Albanais (Veqilharxhi)Autorise des actions clavier à casser les captures (attention : faille de sécurité)Autorise l'enregistrement des captures et arborescences de fenêtresAlt et Meta sont sur les touches AltComportement des touches Alt et WindowsAlt est placé sur Windows droite, Super sur MenuAlt est placé sur les touches Windows (et les touches Alt habituelles)Alt échangé avec WindowsAlt+Verr. maj.Alt+CtrlAlt+Maj.Alt+EspaceAmhariqueN'importe quelle touche AltN'importe quelle touche WindowsN'importe quelle touche Windows (maintenue)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium émule Pause, Impr. écr., Arrêt défil.Apple (portable)ArabeArabe (AZERTY)Arabe (AZERTY, chiffres arabes orientaux)Arabe (Algérie)Arabe (chiffres arabes, extensions au 4e niveau)Arabe (Buckwalter)Arabe (chiffres arabes orientaux)Arabe (chiffres arabes orientaux, extensions au 4e niveau)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (QWERTY)Arabe (QWERTY, chiffres arabes orientaux)Arabe (Sun type 6/7)Arabe (Syrie)ArménienArménien (OLPC, phonétique)Arménien (variante orientale)Arménien (variante phonétique)Arménien (orientale)Arménien (phonétique)Arménien (occidentale)Asturien (Espagne, avec H et L point bas)Asus (portable)En bas à gaucheÀ la touche correspondante sur une disposition Colemak.À la touche correspondante sur une disposition Dvorak.À la touche correspondante d'une disposition QWERTY.AtsinaAvatimeAvestiqueAzériAzéri (cyrillique)Azona RF2300 clavier internet sans filBTC 5090BTC 5113RF multimédiaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarre oblique inverseLa barre oblique inverse, avec un autre sélecteur de niveau 3, verrouille une fois ce niveauBambaraBengaliBengali (Inde)Bengali (Inde, InScript Baishakhi)Bengali (Inde, Baishakhi)Bengali (Inde, Bornona)Bengali (Inde, Gitanjali)Bengali (Inde, Probhat)Bengali (Probhat)BachkirBiélorusseBiélorusse (latin)Biélorusse (international)Biélorusse (obsolète)BelgeBelge (ISO, variante)Belge (variante, Latin-9 uniquement)Belge (Sun type 6/7)Belge (Wang 724 AZERTY)Belge (variante)Belge (sans touche morte)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbère (Algérie, latin)Berbère (Algérie, Tifinagh)Berbère (Maroc, variante Tifinagh)Berbère (Maroc, Tifinagh étendu phonétique)Berbère (Maroc, Tifinagh étendu)Berbère (Maroc, Tifinagh phonétique)Berbère (Maroc, Tifinagh phonétique, variante)Berbère (Maroc, Tifinagh)BosniaqueBosniaque (US)Bosniaque (US, avec digraphes bosniaques)Bosniaque (avec digraphes bosniaques)Bosniaque (avec guillemets)Les deux Alt ensembleLes deux Ctrl ensembleLes deux Maj. ensembleLes 2 touches Maj. ensemble activent Verr. maj.Les 2 touches Maj. ensemble activent le Verr. maj., la touche Maj. le désactiveLes 2 touches Maj. ensemble activent le blocage majusculeBrailleBraille (pour gaucher, pouce inversé)Braille (pour gaucher)Braille (pour droiter, pouce inversé)Braille (pour droiter)Brother InternetBulgareBulgare (amélioré)Bulgare (nouvelle phonétique)Bulgare (phonétique traditionnelle)BirmanBirman ZawgyiCameroun (AZERTY, international)Anglais (Dvorak, international)Cameroun multilingue (QWERTY, international)Canadien (international)Canadien (international, 1re partie)Canadien (international, 2e partie)Verr. maj.Verr. maj. (maintenu), Alt + Verr. maj. joue le rôle original de Verr. maj.Verr. maj. agit comme un verrouillage Maj ; Maj. l'annule temporairementVerr. maj. agit comme Maj. quand il est verrouillé ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj. comme CtrlVerr. maj. comme Ctrl, Ctrl comme HyperComportement de la touche Verr. maj.Verr. maj. est désactivéVerr. maj. (première disposition), Maj. + Verr. maj. (dernière disposition)Verr. maj. bascule le blocage majuscule (affecte toutes les touches)Verr. maj. active ou désactive la mise en majuscule usuelle des caractères alphabétiquesVerr. maj. utilise la mise en majuscule interne ; Maj. annule temporairement Verr. maj.Verr. maj. utilise la mise en majuscule interne ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj., avec un autre sélecteur de niveau 3, verrouille une fois ce niveauCatalan (Espagne, avec L point médian)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (variante)Cherry CyBo@@rd concentrateur USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony internetChicony KB-9885Chicony KU-0108Chicony KU-0108ChinoisChromebookLiturgique slaveChuvashTchouvache (latin)Classmate PCCló GaelachSalish Cœur d'AlèneCompaq Armada (portable)Compaq Easy AccessCompaq Internet (13 touches)Compaq Internet (18 touches)Compaq Internet (7 touches)Compaq Presario (portable)Compaq iPaqOptions de compatibilitéCompositionCopteCreative Desktop Wireless 7000Tatar de Crimée (Q dobroudja)Tatar de Crimée (Alt-Q turc)Tatar de Crimée (F turc)Tatar de Crimée (Q turc)CroateCroate (US)Croate (US, avec les digraphes croates)Croate (avec les digraphes croates)Croate (avec guillemets)Ctrl est placé sur Alt, Alt sur WindowsCtrl est placé sur Windows droite (et les Ctrl habituelles)Ctrl est placé sur les touches Windows (et les Ctrl habituelles)Position de CtrlCtrl+Alt+Eff. arrièreCtrl+Maj.MonnaiesTchèqueTchèque (QWERTY)Tchèque (QWERTY, Macintosh)Tchèque (QWERTY, barre oblique inverse étendue)Tchèque (Sun type 6/7)Tchèque (UCW, lettres accentuées uniquement)Tchèque (Dvorak US, support UCW)Tchèque (codage)Tchèque (programmation)Tchèque (programmation, typographie)Tchèque (typographie)Tchèque (avec la touche <\|>)Tchèque, slovaque et allemand (US)Tchèque, slovaque, polonais, espagnol, finnois, suédois et allemand (US)DTK2000DanoisDanois (Dvorak)Danois (Macintosh)Danois (Macintosh, sans touche morte)Danois (Sun type 6/7)Danois (Windows)Espagnol (sans touche morte)Touches du pavé numérique par défautDellDell PC 101 touchesDell Inspiron 6000/8000 (portable)Dell Latitude (portable)Dell Precision M (portable)Dell Precision M65 (portable)Dell SK-8125Dell SK-8135Dell USB MultimédiaDexxa Wireless DesktopDivehiDiamond 9801/9802NéerlandaisNéerlandais (Macintosh)Danois (Sun type 6/7)Néerlandais (US)Néerlandais (standard)DzongkhaDalécarlien (Suède, avec ogonek combinatoire)Active les caractères APL superposésActive des caractères typographiques supplémentairesAnglais (3l)Anglais (3l, Chromebook)Anglais (3l, Emacs)Anglais (Australien)Anglais (Cameroun)Anglais (Canada)Anglais (Carpalx)Anglais (Carpalx, complètement optimisé)Anglais (Carpalx, complètement optimisé, internat., touches mortes via AltGr)Anglais (Carpalx, complètement optimisé, internat., avec touches mortes)Anglais (Carpalx, internat., touches mortes via AltGr)Anglais (Carpalx, internat., avec touches mortes)Anglais (Colemak)Anglais (Colemak-DH ISO)Anglais (Colemak-DH)Anglais (Drix)Anglais (Dvorak)Anglais (Dvorak, variante internat.)Anglais (Dvorak, internat. avec touches mortes)Anglais (Dvorak, pour gaucher)Anglais (Dvorak pour droitier)Anglais (Ghana)Anglais (Ghana, GILLBT)Anglais (Ghana, multilingue)Anglais (Inde, avec le symbole Roupie)Anglais (Macintosh)Anglais (Mali, US, Macintosh)Anglais (Mali, US, internat.)Anglais (Nigeria)Anglais (Norman)Anglais (Afrique du Sud)Anglais (Royaume-Uni)Anglais (Royaume-Uni, Colemak)Anglais (Royaume-Uni, Colemak-DH)Anglais (Royaume-Uni, Dvorak)Anglais (Royaume-Uni, Dvorak, ponctuation britannique)Anglais (Royaume-Uni, Macintosh)Anglais (Royaume-Uni, Macintosh, international)Anglais (Royaume-Uni, Sun type 6/7)Anglais (Royaume-Uni, étendu, Windows)Anglais (Royaume-Uni, internat., avec touches mortes)Anglais (US)Anglais (US, Arabe IBM 238_L)Anglais (US, Sun type 6/7)Anglais (US, symbolique)Anglais (US, variante internat.)Anglais (US, Euro sur le 5)Anglais (US, international, combinatoire Unicode via AltGr)Anglais (US, international, combinatoire Unicode via AltGr, variante)Anglais (US, internat., avec touches mortes)Anglais (Workman)Anglais (Workman, internat., avec touches mortes)Anglais (Dvorak classique)Anglais (internat., touches mortes via AltGr)Anglais (Dvorak pour programmeur)Anglais (diviser/multiplier bascule la disposition)Ennyah DKB-1008Entrée sur le pavé numériqueEspérantoEspéranto (Brésil, Nativo)Espéranto (Portugal, PT-Nativo)Espéranto (obsolète)Lettres espéranto avec exposantsEstonienEstonien (Dvorak)Estonien (Sun type 6/7)Estonien (US)Estonien (sans touche morte)EurKEY (US)Euro sur le 2Euro sur le 4Euro sur le 5Euro sur le EEverex STEPnoteÉwéFL90FéroïenFéroïen (sans touche morte)FilipinoFilipino (Capewell-Dvorak, baybayin)Filipino (Capewell-Dvorak, latin)Filipino (Capewell-QWERF 2006, baybayin)Filipino (Capewell-QWERF 2006, latin)Filipino (Colemak, baybayin)Filipino (Colemak, latin)Filipino (Dvorak, baybayin)Filipino (Dvorak, latin)Filipino (QWERTY, baybayin)FinnoisFinnois (DAS)Finnois (Dvorak)Finnois (Macintosh)Finnois (Sun type 6/7)Finnois (Windows)Finnois (classique)Finnois (classique, sans touche morte)Touche à quatre niveaux avec le séparateur décimal abstraitTouche à quatre niveaux avec virguleTouche à quatre niveaux avec pointTouche à quatre niveaux avec point, Latin-9 uniquementTouche à quatre niveaux avec le séparateur décimal momayyezFrançaisFrançais (AZERTY)Français (AZERTY, AFNOR)Français (BÉPO)Français (BÉPO, AFNOR)Français (BÉPO, Latin-9 uniquement)Français (breton)Français (Cameroun)Français (Canada)Français (Canada, Dvorak)Français (Canada, obsolète)Français (République démocratique du Congo)Français (Dvorak)Français (Macintosh)Français (Mali, variante)Français (Maroc)Français (Sun type 6/7)Français (Suisse)Français (Suisse, Macintosh)Français (Suisse, Sun type 6/7)Français (Suisse, sans touche morte)Français (Togo)Français (US avec touches mortes, variante)Français (US)Français (US, AZERTY)Français (variante)Français (variante, Latin-9 uniquement)Français (variante, sans touche morte)Français (obsolète, variante)Français (obsolète, variante, sans touche morte)Français (sans touche morte)Frioulan (Italie)Fujitsu-Siemens Amilo (portable)PeulGaPC générique 101 touchesPC générique 102 touchesPC générique 104 touchesPC générique 104 touches avec touche Entrée en LPC générique 105 touchesPC générique 86 touchesGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGéorgienGéorgien (France, AZERTY Tskapo)Géorgien (Italie)Géorgien (MESS)Géorgien (ergonomique)AllemandAllemand (Aus der Neo-Welt)Allemand (Autriche)Allemand (Autriche, Macintosh)Allemand (Autriche, sans touche morte)Allemand (Bone)Allemand (Bone, ß dans la rangée du milieu)Allemand (Dvorak)Allemand (E1)Allemand (E2)Allemand (KOY)Allemand (Ladin)Allemand (Macintosh)Allemand (Macintosh, sans touche morte)Allemand (Neo 2)Allemand (Neo, QWERTY)Allemand (Neo, QWERTZ)Allemand (QWERTY)Allemand (Sun type 6/7)Allemand (Suisse)Allemand (Suisse, Macintosh)Allemand (Suisse, Sun type 6/7)Allemand (Suisse, obsolète)Allemand (Suisse, sans touche morte)Allemand (T3)Allemand (US)Allemand (accent aigu en touche morte)Allemand (accents aigu et grave en touches mortes)Allemand (tilde en touche morte)Allemand (sans touche morte)Allemand (avec lettres hongroises, sans touche morte)Allemand, suédois et finnois (US)GrecGrec (Colemak)Grec (Sun type 6/7)Grec (étendu)Grec (sans touche morte)Grec (polytonique)Grec (simple)GujarâtîGyrationHanyu Pinyin (touches mortes via AltGr)Happy HackingHappy Hacking pour MacHaoussa (Ghana)Haoussa (Nigeria)HawaïenHébreuHébreu (biblique, SIL, phonétique)Hébreu (biblique, Tiro)Hébreu (lyx)Hébreu (phonétique)Hewlett-Packard InternetHewlett-Packard Mini 110 (portable)Hewlett-Packard NEC SK-2500 MultimédiaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadécimalHindi (Bolnagri)Hindi (KaGaPa, phonétique)Hindi (Wx)Honeywell EuroboardHongroisHongrois (QWERTY)Hongrois (QWERTY, 101 touches, virgule, touches mortes)Hongrois (QWERTY, 101 touches, virgule, sans touche morte)Hongrois (QWERTY, 101 touches, point, touches mortes)Hongrois (QWERTY, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (QWERTZ, 101 touches, virgule, touches mortes)Hongrois (QWERTZ, 101 touches, virgule, sans touche morte)Hongrois (QWERTZ, 101 touches, point, touches mortes)Hongrois (QWERTZ, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (sans touche morte)Hongrois (standard)Hyper est placé sur les touches WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandaisIslandais (Dvorak)Islandais (Macintosh)Islandais (Macintosh, obsolète)IgboIndienIndic IPAIndonésien (Arabe pégon, phonétique étendue)Indonésien (Javanais)Indonésien (Latin)Alphabet phonétique internationalInuktitutIrakienIrlandaisIrlandais (UnicodeExpert)ItalienItalien (Dvorak)Italien (IBM 142)Italien (Ladin)Italien (Macintosh)Italien (Sun type 6/7)Italien (US)Italien (Windows)Italien (internat., avec touches mortes)Italien (sans touche morte)JaponaisJaponais (Dvorak)Japonais (Kana 86)Japonais (Kana)Japonais (Macintosh)Japonais (OADG 109A)Japonais (PC-98)Japonais (Sun type 6)Japonais (Sun type 7, compatible PC)Japonais (Sun type 7, compatible Sun)Options des claviers japonaisKabyle (AZERTY, avec touches mortes)Kabyle (QWERTY, Royaume-Uni, avec touches mortes)Kabyle (QWERTY, US, avec touches mortes)KalmykLa touche « verrouillage Kana » verrouilleKannadaKannada (KaGaPa, phonétique)CachoubeKazakhKazakh (latin)Kazakh (étendu)Kazakh (avec russe)Séquence de touches pour tuer le serveur XTouche sélectionnant le niveau 5Touche sélectionnant le niveau 2Touche sélectionnant le niveau 3Keytronic FlexProKhmer (Cambodge)KikuyuKinesisKomiCoréenCoréen (compatible 101/104 touches)Coréen (Sun type 6/7)Touches Hangeul/Hanja coréennesKurde (Iran, arabe-latin)Kurde (Iran, F)Kurde (Iran, Alt-Q latin)Kurde (Iran, Q latin)Kurde (Irak, arabe-latin)Kurde (Irak, F)Kurde (Irak, Alt-Q latin)Kurde (Irak, Q latin)Kurde (Syrie, F)Kurde (Syrie, Alt-Q latin)Kurde (Syrie, Q latin)Kurde (Turquie, F)Kurde (Turquie, Alt-Q latin)Kurde (Turquie, Q latin)KutenaiKirghizeKirghize (phonétique)LaoLao (STEA)LettonLetton (Colemak)Letton (Colemak, avec apostrophe)Letton (Dvorak)Letton (Dvorak, avec Y)Letton (Dvorak, avec moins)Letton (F)Letton (Sun type 6/7)Letton (adapté)Letton (apostrophe)Letton (apostrophe, guillemets en touches mortes)Letton (ergonomique, ŪGJRMV)Letton (moderne)Letton (Dvorak pour le programmeur)Letton (Dvorak pour le programmeur, avec Y)Letton (Dvorak pour le programmeur, avec moins)Letton (tilde)Disposition du pavé numériqueAlt gaucheAlt gauche (maintenu)Alt. gauche pour Ctrl, Ctrl pour Win, Win gauche pour Alt. gaucheAlt gauche échangé avec Windows gaucheAlt gauche+Maj. gaucheCtrl gaucheCtrl gauche comme MétaCtrl gauche (première disposition), Ctrl droit (dernière disposition)Ctrl gauche+Maj. gaucheCtrl gauche + Windows gaucheCtrl gauche + Windows gauche (première disposition), Ctrl droit + Menu (seconde disposition)Maj. gaucheTouche Windows gaucheWindows gauche (maintenu)Windows gauche sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauTouche Windows gauche (première disposition), touche Windows droite (dernière disposition)ObsolèteWang 724 (obsolète)Touche obsolète avec virguleTouche obsolète avec pointLituanienLituanien (Dvorak)Lituanien (IBM LST 1205-92)Lituanien (LEKP)Lituanien (LEKPa)Lituanien (Ratise)Lituanien (Sun type 6/7)Lituanien (US)Lituanien (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (variante)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (variante 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTouches supplémentaires Logitech G15 via le démon G15Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bas-sorabeBas-sorabe (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (Internat.)MacédonienMacédonien (sans touche morte)MacintoshMacintosh (ancien)Faire de Verr. maj. un Effacement. arrière supplémentaire.Faire de Verr. maj. un Ctrl supplémentaire.Faire de Verr. maj. un Échap. supplémentaire.Faire de Verr. maj. un Échap. supplémentaire, mais Maj. + Verr. maj. a l'effet du Verr. maj. habituelFaire de Verr. maj. un Hyper supplémentaireFaire de Verr. maj. une touche Menu supplémentaire.Faire de Verr. maj. un Verr. Num. supplémentaireFaire de Verr. maj. un Super supplémentaire.Faire du Zenkaku Hankaku un Échap. supplémentaire.Alt. droite comme touche hangeulAlt. droite comme touche hanjaCtrl. droite comme touche hangeulCtrl. droite comme touche hanjaMalais (clavier jawi, arabe)Malais (jawi, phonétique)MalayâlamMalayâlam (lalitha)Malayâlam (InScript amélioré avec le roupie)MaltaisMaltais (Royaume-Uni, surcharges via AltGr)Maltais (US)Maltais (US, surcharges via AltGr)Meitei (Eeyek)MaoriMarathe (KaGaPa, phonétique)Marathe (InScript amélioré)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (maintenu), Maj.+Menu pour MenuMenu comme Ctrl droiteMenu sélectionne le niveau 5Menu est placé sur les touches WindowsMéta est placé sur Windows gaucheMéta est placé sur les touches WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (suédois)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB /Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Clavier Microsoft OfficeMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AM'mockModi (phonétique KaGaPa)MoldaveMoldave (Gagaouze)MongolMongol (bichig)Mongol (galik)Mongol (galik mandchou)Mongol (mandchou)Mongol (galik todo)Mongol (todo)Mongol (xibe)MonténégrinMonténégrin (cyrillique)Monténégrin (cyrillique, ZE et ZHE intervertis)Monténégrin (cyrillique, avec guillemets)Monténégrin (latin, QWERTY)Monténégrin (latin, Unicode)Monténégrin (latin, Unicode, QWERTY)Monténégrin (latin, avec guillemets)Multilingue (Canada, Sun type 6/7)N'Ko (AZERTY)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Eff. Arr. du type NICOLA-FNépalaisEspace insécable au niveau 2Espace insécable au niveau 3Espace insécable au niveau 3, rien au niveau 4Espace insécable au niveau 3, espace fine insécable au niveau 4Espace insécable au niveau 4Espace insécable au niveau 4, espace fine insécable au niveau 6Espace insécable au niveau 4, espace fine insécable au niveau 6 (via Ctrl+Maj.)Entrée d'une espace insécableSami du Nord (Finlande)Sami du Nord (Norvège)Sami du Nord (Norvège, sans touche morte)Sami du Nord (Suède)Northgate OmniKey 101NorvégienNorvégien (Colemak)Norvégien (Dvorak)Norvégien (Macintosh)Norvégien (Macintosh, sans touche morte)Norvégien (Sun type 6/7)Norvégien (Windows)Norvégien (sans touche morte)Verr. Num.Verr. num. activé : chiffres ; maj. pour les flèches. Verr. num. désactivé : flèches (comme Windows)Touche numérique 4 pour un appui isoléTouche numérique 9 pour un appui isoléComportement de la touche de Suppr. du pavé numériqueLes touches du pavé numérique sont toujours numériques (comme sur Mac OS)OLPCOccitanOghamOgham (IS434)SantaliRunes HongroisesAncien hongrois (pour les ligatures)Compatibilité avec les anciens codes des touches SolarisTurc ancienOriyaOriya (Bolnagri)Oriya (Wx)Ortek MCK-800 Multimédia/InternetOssète (Géorgie)Ossète (Windows)Ossète (obsolète)Turc ottomanTurc ottoman (F)PC-98Ruthène pannonienPosition des parenthèsesPachtoPachto (Afghanistan, OLPC)PausePersanPersan (Afghanistan, Dari, OLPC)Persan (avec pavé numérique persan)Type DAB ou téléphonePolonaisPolonais (clavier anglais)Polonais (Colemak)Polonais (Colemak-DH)Polonais (Dvorak)Polonais (Dvorak, guillemets polonais sur le 1)Polonais (Dvorak, guillemets polonais sur la touche guillemets)Polonais (Allemagne, sans touche morte)Polonais (glagolitique)Polonais (QWERTZ)Polonais (Sun type 6/7)Polonais (internat., avec touches mortes)Polonais (obsolète)Polonais (Dvorak pour le programmeur)PortugaisPortugais (Brésil)Portugais (Brésil, Dvorak)Portugais (Brésil, ThinkPad IBM/Lenovo)Portugais (Brésil, Nativo pour claviers US)Portugais (Brésil, Nativo)Portugais (Brésil, Sun type 6/7)Portugais (Brésil, sans touche morte)Portugais (Colemak)Portugais (Macintosh)Portugais (Macintosh, sans touche morte)Portugais (Nativo pour claviers US)Portugais (PT-Nativo)Portugais (Sun type 6/7)Portugais (sans touche morte)Position de la touche ComposePropeller Voyager KTEZ-1000Impr. Écr.Penjabi (Gurmukhî, Jhelum)Penjabi (Gurmukhî)QTronix Scorpius 98N+Alt droiteAlt droite (maintenu)Alt droite sélectionne le niveau 5Alt. droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauAlt droite ne sélectionne jamais le niveau 3Alt droite, Maj. + Alt droite est la touche composeCtrl droiteCtrl droite (maintenu)Ctrl droite comme Alt droiteCtrl droite + Maj. droiteMaj. droiteWindows droiteWindows droite (maintenu)Windows droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauRoumainRoumain (Allemagne)Roumain (Allemagne, sans touche morte)Roumain (Sun type 6/7)Roumain (Windows)Roumain (ergonomique dactylographique)Roumain (standard)Roupie sur le 4RusseRusse (Biélorusse)Russe (Tchèque, phonétique)Russe (DOS)Russe (Géorgie)Russe (Allemagne, phonétique)Russe (Allemagne, recommandé)Russe (Allemagne, translittération)Russe (Kazakhstan, avec kazakh)Russe (Macintosh)Russe (Pologne, Dvorak phonétique)Russe (polyglotte et réactionnaire)Russe (Rulemak, Colemak phonétique)Russe (Sun type 6/7)Russe (Suède, phonétique)Russe (Suède, phonétique, sans touche morte)Russe (US, phonétique)Russe (Ukraine, RSTU standard)Russe (obsolète)Russe (Macintosh phonétique)Russe (phonétique)Russe (phonétique, AZERTY)Russe (phonétique, Dvorak)Russe (phonétique, français)Russe (phonétique, Windows)Russe (phonétique, YAZHERTY)Russe (machine à écrire)Russe (machine à écrire, obsolète)Russe (avec ponctuation US)Russe (Ukrainien-Biélorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taïwan)SamogitienSamsung SDM 4500PSamsung SDM 4510PSanscrit (KaGaPa, phonétique)Symboles sanscritSanwa Supply SKB-KG3Arrêt défilementSecwepemctsinPoint-virgule au niveau 3SerbeSerbe (cyrillique, ZE et ZHE intervertis)Serbe (cyrillique, avec guillemets)Serbe (Latin)Serbe (Latin, QWERTY)Serbe (latin, Unicode)Serbe (latin, Unicode, QWERTY)Serbe (Latin, avec guillemets)Serbe (Russe)Serbe (accents combinatoires à la place des touches mortes)Serbo-Croate (US)Maj. + VerrNum bascule le contrôle souris au clavier (PointerKeys) Maj. annule Verr. maj.Maj. n'annule pas Verr. num., mais sélectionne le niveau 3Maj.+ Verr. maj.SicilienSicilien (clavier US)SilésienSilvercrest Multimedia WirelessSindhîCingalais (US)Cingalais (phonétique)SlovaqueSlovaque (disposition ACC, lettres accentuées uniquement)Slovaque (QWERTY)Slovaque (QWERTY, barre oblique inverse étendue)Slovaque (Sun type 6/7)Slovaque (barre oblique inverse étendue)SlovèneSlovène (US)Slovène (avec guillemets)EspagnolEspagnol (Dvorak)Espagnol (Amérique latine)Espagnol (Amérique latine, Colemak spécial jeux)Espagnol (Amérique latine, Colemak)Espagnol (Amérique latine, Dvorak)Espagnol (Amérique latine, tilde en touche morte)Espagnol (Amérique latine, sans touche morte)Espagnol (Macintosh)Espagnol (Sun type 6/7)Espagnol (Windows)Espagnol (tilde en touche morte)Espagnol (sans touche morte)Les combinaisons spéciales (Ctrl+Alt+<touche>) sont traitées par le serveur XSteelSeries Apex 300 (Apex RAW)Sun type 6 (Japon)Sun type 6 USB (Japon)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europe)Sun type 7 USBSun type 7 USB (Europe)Sun type 7 USB (Japon)/Japonais 106 touchesSun type 7 USB (Unix)Compatibilité avec les touches SunSuper Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Intervertir Ctrl et Verr. maj.Intervertir Échap. et Verr. maj.Échange Alt. gauche et Ctrl gaucheÉchange Win gauche et Ctrl gaucheÉchange Win droite et Ctrl droiteÉchangé avec les crochetsSuédoisSuédois (Dvorak A5)Suédois (Dvorak)Suédois (Dvorak, international)Suédois (Macintosh)Suédois (Sun type 6/7)Suédois (Svdvorak)Suédois (US)Suédois (sans touche morte)Langue des signes suédoisePassage à une autre dispositionSymplon PaceBook (tablette)SyriaqueSyriaque (phonétique)TaïwanaisTaïwanais (indigène)TadjikTadjik (obsolète)Tamoul (InScript)Tamoul (Sri Lanka, TamilNet '99)Tamoul (Sri Lanka, TamilNet '99, codage TAB)Tamoul (TamilNet '99 avec chiffres tamouls)Tamoul (TamilNet '99)Tamoul (TamilNet '99, codage TAB)Tamoul (TamilNet '99, codage TSCII)Targa Visionary 811TatarTélougouTélougou (KaGaPa, phonétique)Télougou (Sarala)ThaïThaï (Pattachote)Thaï (TIS-820.2538)La touche « < > »La touche « < > » sélectionne le niveau 5La touche « < > » sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauLa touche « < > », avec un autre sélecteur de niveau 3, verrouille une fois ce niveauTibétainTibétain (avec chiffres ASCII)À gauche du « A »Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Allemagne)Turc (Sun type 6/7)Turc (internat., avec touches mortes)TurkmèneTurkmène (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)OudmourteOugaritique à la place de l'arabeUkrainienUkrainien (Sun type 6/7)Ukrainien (Windows)Ukrainien (homophonique)Ukrainien (obsolète)Ukrainien (phonétique)Ukrainien (RSTU standard)Ukrainien (machine à écrire)Opérateurs mathématiques et flèches UnicodeOpérateurs mathématiques et flèches Unicode au niveau par défautUnitek KB-1925Ourdou (Pakistan)Ourdou (Pakistan, CRULP)Ourdou (Pakistan, NLA)Ourdou (Windows)Ourdou (variante phonétique)Ourdou (phonétique)Utiliser les LED clavier pour indiquer les modificateursUtiliser les LED clavier pour indiquer une disposition alternativeL'espace habituelle quel que soit le niveauOuïghourOuzbekOuzbek (Afghanistan)Ouzbek (Afghanistan, OLPC)Ouzbek (latin)VietnamienVietnamien (AÐERTY)Vietnamien (français)Vietnamien (QĐERTY)Vietnamien (US)ViewSonic KU-306 InternetPavé Wang 724 avec opérateurs mathématiques et flèches UnicodePavé Wang 724 avec opérateurs mathématiques et flèches Unicode au niveau par défautLa touche Windows est placé sur Impr. écr. (en plus de la touche Windows)Windows+EspaceWinbook Model XP5WolofYahoo! InternetIakuteYorubaAntiliant sans chasse au niveau 2Antiliant sans chasse au niveau 2. espace insécable au niveau 3Antiliant sans chasse au niveau 2, espace insécable au niveau 3, rien au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, espace fine insécable au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, liant sans chasse au niveau 4Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3, espace insécable au niveau 4Antiliant sans chasse au niveau 3, liant sans chasse au niveau 4akamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcspersonnalisédadede_llddlgdvdzeMachines m6800 (portable)eeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh@ 1.1.1.6 log @initial import of xkeyboard-config-2.34 @ text @d1 62 a62 62 &ULpeqeeeeee ef 4f AfNfnfrfff%f%f g g -g7g Ig%Ug{ggggggCg"h4hLh)ah&hh hh h hhhi i%i+iBiXi2ni iii(ii5i5j Ij=jjjj jjj(j%k;kJkSkmkkkkk)k ll,!l+Nl+zllll llllm m (m4m =m Gm Rm+\m mTmmmm"n(nBnZntnn n nnnnnn o&o=oWofo }oooooo,o#,p#Pp)tppp p#ppq,q>qQq$eq?q%qq$qr%3rYrpr rrr rrrr s%#sIsZsus sJs>sE$tjt |ttt9t/u@@0u@@quGuTu"Ovrv{vvvvvvw0wAwQwawqw ywwww w wwwwxx5xNx exqxxxxxxxy!y *y%8y!^yy!y.y(y z#z 6zAzPzVzez"zz"zz z{ {={Q{m{@@{{{{{ {|4|E|[|w||||||| | | } }7}?}Q}W}i} ~}}}*}}#} ~~6~J~_~r~~$~A~;~.8(g ')QoԀ"<N_ v)ǁ (C#c ΂,2C#v(Ճ%/0`p „#Մ ,: R ^ h r |$Dž!(%7]zɆ   7I['{%Շ/ FTiψ)!4HYo""lj % 9Gc#ϊ+*>i|&ɋ 1BRgn Ԍ%  $ 0=L _ɍߍ"7"T w ю- 6<Lar# ޏ  )0P hu&"$GgǑ  1< PZ-m0+̒.-'0U+.-0+@@.l-0ɔ+.&Unϕ -7J`~ *Ֆ( 1;AG]ev ×З"4GWl$%͘ #-#Qu| ™əؙ!":VrК.Jbś؛"@@Zbi{ "ǜ؜ 1C!Xz#ĝ' 9B8[! ʞԞ40DC `7NUe{ ˠݠ.DM] w #١!( H+i%͢'8H]m%) ܣ 1< V `&n! Pؤ")%L%r"&6Rp )Ϧ"צ "*;A\x}) #>Tq  Ϩ& "1)T~"ͩԩ  %7Pcz *'.$K$p# ǫ ӫ ߫ ##;=_M#M^]խ%,D Zdx#Ůޮ K&`&1ͯ  )7"U x !ְ "(8MTou }бױ,&4Sʲ 9DX(t,ʳ!!*?$V${δ"<O eoa!%) OZu aԶ6? Rs ѷܷ 6Ug"!Ÿ!"#@@d{( ֹ%8Snº׺+> R` r}λ &#Eiy ˼0.$Bg9ɽҽ &9*@@k#{ Ѿ۾,8!e $&Ϳ1F7] (7*Q|.Kj +A]u| -(#L"a$ %3kY^$,J]u +KSc|.* 2<Ui!2. =Kcs&+&?FL` z 6G2(z &K eUuo1JoJ\/258;>ADGJMPVZ^adgknqtwz}   !$(+.147:=ADGJMPSVZ]`cfilosvy|L$c'$''*6 a n{&&; S ak}2WDi$'1G-u +.4Ka9w)0C!V:x )* ? MWu )%58F75  &!HQ h r~ +^GOW"f 'C[a$w #>#\."&0* EO)^%/P>9&&6M^f{$ ,B$[# LIZF'$MDm[XVgO'6?R#k #3C KVgo 4 O[ u '*#Rv(<A7H _ir{1.!#EW%p$#JAIP`%s' "AZv  /AY/b&6 *?Rc*uPK6=1t$"/Gw&!5Sq!6" Y/z#'5 ,9Wr ;E,Jw1-!3&Zj  ! ' ?M j v  $!(A%j .?Sj|&>%#7@@>x %?Rgz. &8Qd %,-(B'k2 7<?Zu3& 4O` r!|&2Y-i  '"3Jas$  *&82_ 5").=Q`y  '  &$.S lz#'"2Uu ' CNbk7}:58&7_:587A:y587# :[ 5 8  " (6 _ p         % F K  R 0\   " +      # = E V h x    (    " 5 E Z o  $ %  $ 1$(V. +!K!m!$ ,Mgw-DWt !& BMct1#+ /9ix A($ ;GG_] :F\nv\ BLa  #2GP`$z #!*& Q+r7'+Scx%+ , LX x<,/g/,41-+4Y !- HS/h+ " /MRaz$'#(4]z! ' "< )_   "    !!!*!9!Q!c! w! ! !!1!+!"8"&W"&~""" " " " " "# !#+#I#/g#A##A#Q9$$$$*$%% 2%=%R%f%)}%%%% %l&(m&(&7&L&D'I'Q' W'e'm'$~'9' '''' ("(>(Q(c( w((((((((( (%)>)V)_)z)))/)?)'%*M*e*w*)***%* ++%+(A+,j++!+&++,(&,#O,s,,,,, ,-"-6- L-W-#m-k---3+. _.k... ...n.^/f/&z///&//000.0 L0X0 n0000$01#1#51$Y1$~111.122:2L2j2~222223%+3Q3m33 33 33334 454 H4V4p4)v4#4 44445 =5<K55D55;526C6L6 b6l66666:6617C7)[77 7777727$!8#F82j8.8888 9-9UJ99999::+:::+R:~:#:::::!;#3;"W;"z;;;;; ; <<7< K<Y<v< <<<< <<==+= ==,^=+==!=#=>'> ->7>W>j>p>>>4>{>ae? ???@@ @@4@@H@@\@@k@@@@@@ @@@@@@@@%@@ @@@@ A$AAA.^A*A A"A AABB5BKBcB}B.BDBCC/CIC[CtCCCC8CBD+KD wDDDDD DDDDE#EB=EYEKE&F5FGFMF]FdF!kF@@FRFd!G_G@@G_'H@@HHHHHHHHHHHHHHHHIII I IIII I)I,I/I6I:I=I@@I[I^IaIdIgIjImIpIsIvIyI|IIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIJJJ J JJJ J&J)J,J/J2J5J8J;J>JAJEJIJMJPJTJWJZJ]J`JcJfJiJmJpJsJvJyJ|JJJJJJJJJJJJJJ~p-?DqX)gDWU5i9PWVOuz>WG@@,g'$] [J6a 5LSg 9R.Nl Rpy!`T1<8s KuTX~1VHwa"e?^<Gmbd4VewD.-$<"GqCUQ&j\Hh2RD 8=zb;%2C>F'b=r_PS]n!{,_||,mzz7j3; 5PQ0Sx)8c.Qsk=*)Iw*P@@mjLS-r7hgI164Y|hX%Z uO)v0ZT#7!d }+53Zy kqc}hH`jJ.:MB]{U&M{ /6V2Kf% sHKcceWn%/f,1AU(#[vhM4:^T'9&A46[/;o@@ H oJkiU`(Z w?_;V!)lC:i Z@@3s8EkG{-A{rtI*1>*FR 7y#w^eO^2|E90qG@@#&CNv domyLBFt0~'_x[Y$f ~Ql"(n0:boiR8OLY`>Ft\=n rLQFK7 E<p *afK\5xP?o/,NXa +^3e+O$\Nl9k (B;"? 3y\cSJ":JB]| +as`b}zg+(xYd$XD /qu A4p Nt=tjME}v2mn!'<-&WM >x#IfAuprEv[TdiIYBC%}_~.]6l3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right Win3rd level of the "< >" keyA user-defined custom LayoutA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL symbols (APLX unified)APL symbols (Dyalog APL)APL symbols (IBM APL2)APL symbols (Manugistics APL*PLUS II)APL symbols (SAX, Sharp APL for Unix)APL symbols (unified)Acer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Albanian (Veqilharxhi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt and Win behaviorAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium emulates Pause, PrtSc, Scroll LockApple laptopArabicArabic (AZERTY)Arabic (AZERTY, Eastern Arabic numerals)Arabic (Algeria)Arabic (Arabic numerals, extensions in the 4th level)Arabic (Buckwalter)Arabic (Eastern Arabic numerals)Arabic (Eastern Arabic numerals, extensions in the 4th level)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (QWERTY, Eastern Arabic numerals)Arabic (Sun Type 6/7)Arabic (Syria)ArmenianArmenian (OLPC, phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and L)Asus laptopAt the bottom leftAt the corresponding key in a Colemak layoutAt the corresponding key in a Dvorak layoutAt the corresponding key in a QWERTY layoutAtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 Wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi InScript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Gitanjali)Bangla (India, Probhat)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (intl.)Belarusian (legacy)BelgianBelgian (ISO, alt.)Belgian (Latin-9 only, alt.)Belgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt.)Belgian (no dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh phonetic, alt.)Berber (Morocco, Tifinagh)BosnianBosnian (US)Bosnian (US, with Bosnian digraphs)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed inverted thumb)Braille (left-handed)Braille (right-handed inverted thumb)Braille (right-handed)Brother InternetBulgarianBulgarian (enhanced)Bulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon (AZERTY, intl.)Cameroon (Dvorak, intl.)Cameroon Multilingual (QWERTY, intl.)Canadian (intl.)Canadian (intl., 1st part)Canadian (intl., 2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock as Ctrl, Ctrl as HyperCaps Lock behaviorCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles Shift Lock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (alt.)Cherry CyBo@@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChromebookChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCompatibility optionsComposeCopticCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US)Croatian (US, with Croatian digraphs)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt, Alt to WinCtrl is mapped to Right Win and the usual CtrlCtrl is mapped to Win and the usual CtrlCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCurrency signsCzechCzech (QWERTY)Czech (QWERTY, Macintosh)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (coder)Czech (programming)Czech (programming, typographic)Czech (typographic)Czech (with <\|> key)Czech Slovak and German (US)Czech, Slovak, Polish, Spanish, Finnish, Swedish and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Windows)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (US)Dutch (standard)DzongkhaElfdalian (Swedish, with combining ogonek)Enable APL overlay charactersEnable extra typographic charactersEnglish (3l)English (3l, Chromebook)English (3l, emacs)English (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Colemak-DH ISO)English (Colemak-DH)English (Drix)English (Dvorak)English (Dvorak, Macintosh)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Colemak-DH)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Macintosh, intl.)English (UK, Sun Type 6/7)English (UK, extended, Windows)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, Symbolic)English (US, alt. intl.)English (US, euro on 5)English (US, intl., AltGr Unicode combining)English (US, intl., AltGr Unicode combining, alt.)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (legacy)Esperanto letters with superscriptsEstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US)Estonian (no dead keys)EurKEY (US)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Dvorak)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Windows)Finnish (classic)Finnish (classic, no dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (AZERTY, AFNOR)French (BEPO)French (BEPO, AFNOR)French (BEPO, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Togo)French (US with dead keys, alt.)French (US)French (US, AZERTY)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (no dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PCGeneric 104-key PCGeneric 104-key PC with L-shaped Enter keyGeneric 105-key PCGeneric 86-key PCGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Bone)German (Bone, eszett in the home row)German (Dvorak)German (E1)German (E2)German (KOY)German (Ladin)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo, QWERTY)German (Neo, QWERTZ)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (T3)German (US)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters, no dead keys)German, Swedish and Finnish (US)GreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHanyu Pinyin (with AltGr dead keys)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HawaiianHebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa, phonetic)Hindi (Wx)Honeywell EuroboardHungarianHungarian (QWERTY)Hungarian (QWERTY, 101-key, comma, dead keys)Hungarian (QWERTY, 101-key, comma, no dead keys)Hungarian (QWERTY, 101-key, dot, dead keys)Hungarian (QWERTY, 101-key, dot, no dead keys)Hungarian (QWERTY, 102-key, comma, dead keys)Hungarian (QWERTY, 102-key, comma, no dead keys)Hungarian (QWERTY, 102-key, dot, dead keys)Hungarian (QWERTY, 102-key, dot, no dead keys)Hungarian (QWERTZ, 101-key, comma, dead keys)Hungarian (QWERTZ, 101-key, comma, no dead keys)Hungarian (QWERTZ, 101-key, dot, dead keys)Hungarian (QWERTZ, 101-key, dot, no dead keys)Hungarian (QWERTZ, 102-key, comma, dead keys)Hungarian (QWERTZ, 102-key, comma, no dead keys)Hungarian (QWERTZ, 102-key, dot, dead keys)Hungarian (QWERTZ, 102-key, dot, no dead keys)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)IgboIndianIndic IPAIndonesian (Arab Pegon, extended phonetic)Indonesian (Javanese)Indonesian (Latin)International Phonetic AlphabetInternational Phonetic Alphabet (QWERTY)InuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (Dvorak)Italian (IBM 142)Italian (Ladin)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US)Italian (Windows)Italian (intl., with dead keys)Italian (no dead keys)JapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7, PC-compatible)Japanese (Sun Type 7, Sun-compatible)Japanese keyboard optionsKabyle (AZERTY, with dead keys)Kabyle (QWERTY, UK, with dead keys)Kabyle (QWERTY, US, with dead keys)KalmykKana Lock key is lockingKannadaKannada (KaGaPa, phonetic)KashubianKazakhKazakh (Latin)Kazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 2nd levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104-key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA)LatvianLatvian (Colemak)Latvian (Colemak, with apostrophe)Latvian (Dvorak)Latvian (Dvorak, with Y)Latvian (Dvorak, with minus)Latvian (F)Latvian (Sun Type 6/7)Latvian (adapted)Latvian (apostrophe)Latvian (apostrophe, dead quotes)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer Dvorak)Latvian (programmer Dvorak, with Y)Latvian (programmer Dvorak, with minus)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (Dvorak)Lithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Ratise)Lithuanian (Sun Type 6/7)Lithuanian (US)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMake Caps Lock an additional BackspaceMake Caps Lock an additional CtrlMake Caps Lock an additional EscMake Caps Lock an additional Esc, but Shift + Caps Lock is the regular Caps LockMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMake right Alt a Hangul keyMake right Alt a Hanja keyMake right Ctrl a Hangul keyMake right Ctrl a Hanja keyMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced InScript, with rupee)MalteseMaltese (UK, with AltGr overrides)Maltese (US)Maltese (US, with AltGr overrides)Manipuri (Eeyek)MaoriMarathi (KaGaPa, phonetic)Marathi (enhanced InScript)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMenu chooses 5th levelMenu is mapped to WinMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AMmuockModi (KaGaPa phonetic)MoldavianMoldavian (Gagauz)MongolianMongolian (Bichig)Mongolian (Galik)Mongolian (Manchu Galik)Mongolian (Manchu)Mongolian (Todo Galik)Mongolian (Todo)Mongolian (Xibe)MontenegrinMontenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Cyrillic, with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Montenegrin (Latin, with guillemets)Multilingual (Canada, Sun Type 6/7)N'Ko (AZERTY)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Non-breaking space inputNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Windows)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrows. Num Lock off: arrows (as in Windows)Number key 4 when pressed in isolationNumber key 9 when pressed in isolationNumeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOld Hungarian (for ligatures)Old Solaris keycodes compatibilityOld TurkicOld Turkic (F)OriyaOriya (Bolnagri)Oriya (Wx)Ortek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Windows)Ossetian (legacy)OttomanOttoman (F)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)Phone and ATM stylePolishPolish (British keyboard)Polish (Colemak)Polish (Colemak-DH)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (lefty)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Colemak)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th levelRight Alt chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Windows)Romanian (ergonomic Touchtype)Romanian (standard)Rupee on 4RussianRussian (Belarus)Russian (Czech, phonetic)Russian (DOS)Russian (GOST 14289-88)Russian (GOST 6431-75, 48-key)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic Macintosh)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, Windows)Russian (phonetic, YAZHERTY)Russian (typewriter)Russian (typewriter, legacy)Russian (with US punctuation)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)SamogitianSamsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa, phonetic)Sanskrit symbolsSanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic, ZE and ZHE swapped)Serbian (Cyrillic, with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Latin, with guillemets)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US)Sinhala (phonetic)SlovakSlovak (ACC layout, only accented letters)Slovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Colemak for gaming)Spanish (Latin American, Colemak)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Windows)Spanish (dead tilde)Spanish (no dead keys)Special keys (Ctrl+Alt+<key>) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Sun key compatibilitySuper Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap Esc and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Dvorak, intl.)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (InScript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa, phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)The "< >" keyThe "< >" key chooses 5th levelThe "< >" key chooses 5th level and acts as a one-time lock if pressed with another 5th level chooserThe "< >" key; acts as onetime lock when pressed together with another 3rd level chooserTibetanTibetan (with ASCII numerals)To the left of "A"Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Windows)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode arrows and math operatorsUnicode arrows and math operators on default levelUnitek KB-1925Urdu (Navees)Urdu (Navees, Pakistan)Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Windows)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to indicate modifiersUse keyboard LED to show alternative layoutUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseVietnamese (AÐERTY)Vietnamese (French)Vietnamese (QĐERTY)Vietnamese (US)ViewSonic KU-306 InternetWang 724 keypad with Unicode arrows and math operatorsWang 724 keypad with Unicode arrows and math operators on default levelWin is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcscustomdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config 2.33.99 d64 1 a64 1 PO-Revision-Date: 2021-09-20 21:42+0200 d73 1 a73 1 Niveau 3 de Verr. Maj.Niveau 3 de la touche Ctrl de gaucheNiveau 3 de la touche Windows de gaucheNiveau 3 de menuNiveau 3 de la touche Ctrl de droiteNiveau 3 de la touche Windows de droiteNiveau 3 de la touche « < > »Une disposition définie par l'utilisateurA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSymboles APL (APLX unifié)symboles APL (APL Dyalog)Symboles APL (IBM APL2)Symboles APL (Manugistics APL*PLUS II)Symboles APL (SAX, Sharp APL for Unix)Symboles APL (unifiés)Acer AirKey VAcer C300Acer Ferrari 4000Acer (portable)Ajouter du comportement standard à la touche MenuAdvance Scorpius KIAfghanAkanAlbanaisAlbanais (Plisi)Albanais (Veqilharxhi)Autorise des actions clavier à casser les captures (attention : faille de sécurité)Autorise l'enregistrement des captures et arborescences de fenêtresAlt et Meta sont sur les touches AltComportement des touches Alt et WindowsAlt est placé sur Windows droite, Super sur MenuAlt est placé sur les touches Windows (et les touches Alt habituelles)Alt échangé avec WindowsAlt+Verr. maj.Alt+CtrlAlt+Maj.Alt+EspaceAmhariqueN'importe quelle touche AltN'importe quelle touche WindowsN'importe quelle touche Windows (maintenue)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium émule Pause, Impr. écr., Arrêt défil.Apple (portable)ArabeArabe (AZERTY)Arabe (AZERTY, chiffres arabes orientaux)Arabe (Algérie)Arabe (chiffres arabes, extensions au 4e niveau)Arabe (Buckwalter)Arabe (chiffres arabes orientaux)Arabe (chiffres arabes orientaux, extensions au 4e niveau)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (QWERTY)Arabe (QWERTY, chiffres arabes orientaux)Arabe (Sun type 6/7)Arabe (Syrie)ArménienArménien (OLPC, phonétique)Arménien (variante orientale)Arménien (variante phonétique)Arménien (orientale)Arménien (phonétique)Arménien (occidentale)Asturien (Espagne, avec H et L point bas)Asus (portable)En bas à gaucheÀ la touche correspondante sur une disposition Colemak.À la touche correspondante sur une disposition Dvorak.À la touche correspondante d'une disposition QWERTY.AtsinaAvatimeAvestiqueAzériAzéri (cyrillique)Azona RF2300 clavier internet sans filBTC 5090BTC 5113RF multimédiaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBarre oblique inverseLa barre oblique inverse, avec un autre sélecteur de niveau 3, verrouille une fois ce niveauBambaraBengaliBengali (Inde)Bengali (Inde, InScript Baishakhi)Bengali (Inde, Baishakhi)Bengali (Inde, Bornona)Bengali (Inde, Gitanjali)Bengali (Inde, Probhat)Bengali (Probhat)BachkirBiélorusseBiélorusse (latin)Biélorusse (international)Biélorusse (obsolète)BelgeBelge (ISO, variante)Belge (variante, Latin-9 uniquement)Belge (Sun type 6/7)Belge (Wang 724 AZERTY)Belge (variante)Belge (sans touche morte)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbère (Algérie, latin)Berbère (Algérie, Tifinagh)Berbère (Maroc, variante Tifinagh)Berbère (Maroc, Tifinagh étendu phonétique)Berbère (Maroc, Tifinagh étendu)Berbère (Maroc, Tifinagh phonétique)Berbère (Maroc, Tifinagh phonétique, variante)Berbère (Maroc, Tifinagh)BosniaqueBosniaque (US)Bosniaque (US, avec digraphes bosniaques)Bosniaque (avec digraphes bosniaques)Bosniaque (avec guillemets)Les deux Alt ensembleLes deux Ctrl ensembleLes deux Maj. ensembleLes 2 touches Maj. ensemble activent Verr. maj.Les 2 touches Maj. ensemble activent le Verr. maj., la touche Maj. le désactiveLes 2 touches Maj. ensemble activent le blocage majusculeBrailleBraille (pour gaucher, pouce inversé)Braille (pour gaucher)Braille (pour droiter, pouce inversé)Braille (pour droiter)Brother InternetBulgareBulgare (amélioré)Bulgare (nouvelle phonétique)Bulgare (phonétique traditionnelle)BirmanBirman ZawgyiCameroun (AZERTY, international)Anglais (Dvorak, international)Cameroun multilingue (QWERTY, international)Canadien (international)Canadien (international, 1re partie)Canadien (international, 2e partie)Verr. maj.Verr. maj. (maintenu), Alt + Verr. maj. joue le rôle original de Verr. maj.Verr. maj. agit comme un verrouillage Maj ; Maj. l'annule temporairementVerr. maj. agit comme Maj. quand il est verrouillé ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj. comme CtrlVerr. maj. comme Ctrl, Ctrl comme HyperComportement de la touche Verr. maj.Verr. maj. est désactivéVerr. maj. (première disposition), Maj. + Verr. maj. (dernière disposition)Verr. maj. bascule le blocage majuscule (affecte toutes les touches)Verr. maj. active ou désactive la mise en majuscule usuelle des caractères alphabétiquesVerr. maj. utilise la mise en majuscule interne ; Maj. annule temporairement Verr. maj.Verr. maj. utilise la mise en majuscule interne ; Maj. n'a pas d'effet sur Verr. maj.Verr. maj., avec un autre sélecteur de niveau 3, verrouille une fois ce niveauCatalan (Espagne, avec L point médian)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@@rdCherry Blue Line CyBo@@rd (variante)Cherry CyBo@@rd concentrateur USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony internetChicony KB-9885Chicony KU-0108Chicony KU-0108ChinoisChromebookLiturgique slaveChuvashTchouvache (latin)Classmate PCCló GaelachSalish Cœur d'AlèneCompaq Armada (portable)Compaq Easy AccessCompaq Internet (13 touches)Compaq Internet (18 touches)Compaq Internet (7 touches)Compaq Presario (portable)Compaq iPaqOptions de compatibilitéCompositionCopteCreative Desktop Wireless 7000Tatar de Crimée (Q dobroudja)Tatar de Crimée (Alt-Q turc)Tatar de Crimée (F turc)Tatar de Crimée (Q turc)CroateCroate (US)Croate (US, avec les digraphes croates)Croate (avec les digraphes croates)Croate (avec guillemets)Ctrl est placé sur Alt, Alt sur WindowsCtrl est placé sur Windows droite (et les Ctrl habituelles)Ctrl est placé sur les touches Windows (et les Ctrl habituelles)Position de CtrlCtrl+Alt+Eff. arrièreCtrl+Maj.MonnaiesTchèqueTchèque (QWERTY)Tchèque (QWERTY, Macintosh)Tchèque (QWERTY, barre oblique inverse étendue)Tchèque (Sun type 6/7)Tchèque (UCW, lettres accentuées uniquement)Tchèque (Dvorak US, support UCW)Tchèque (codage)Tchèque (programmation)Tchèque (programmation, typographie)Tchèque (typographie)Tchèque (avec la touche <\|>)Tchèque, slovaque et allemand (US)Tchèque, slovaque, polonais, espagnol, finnois, suédois et allemand (US)DTK2000DanoisDanois (Dvorak)Danois (Macintosh)Danois (Macintosh, sans touche morte)Danois (Sun type 6/7)Danois (Windows)Espagnol (sans touche morte)Touches du pavé numérique par défautDellDell PC 101 touchesDell Inspiron 6000/8000 (portable)Dell Latitude (portable)Dell Precision M (portable)Dell Precision M65 (portable)Dell SK-8125Dell SK-8135Dell USB MultimédiaDexxa Wireless DesktopDivehiDiamond 9801/9802NéerlandaisNéerlandais (Macintosh)Danois (Sun type 6/7)Néerlandais (US)Néerlandais (standard)DzongkhaDalécarlien (Suède, avec ogonek combinatoire)Active les caractères APL superposésActive des caractères typographiques supplémentairesAnglais (3l)Anglais (3l, Chromebook)Anglais (3l, Emacs)Anglais (Australien)Anglais (Cameroun)Anglais (Canada)Anglais (Carpalx)Anglais (Carpalx, complètement optimisé)Anglais (Carpalx, complètement optimisé, internat., touches mortes via AltGr)Anglais (Carpalx, complètement optimisé, internat., avec touches mortes)Anglais (Carpalx, internat., touches mortes via AltGr)Anglais (Carpalx, internat., avec touches mortes)Anglais (Colemak)Anglais (Colemak-DH ISO)Anglais (Colemak-DH)Anglais (Drix)Anglais (Dvorak)Anglais (Dvorak, Macintosh)Anglais (Dvorak, variante internat.)Anglais (Dvorak, internat. avec touches mortes)Anglais (Dvorak, pour gaucher)Anglais (Dvorak pour droitier)Anglais (Ghana)Anglais (Ghana, GILLBT)Anglais (Ghana, multilingue)Anglais (Inde, avec le symbole Roupie)Anglais (Macintosh)Anglais (Mali, US, Macintosh)Anglais (Mali, US, internat.)Anglais (Nigeria)Anglais (Norman)Anglais (Afrique du Sud)Anglais (Royaume-Uni)Anglais (Royaume-Uni, Colemak)Anglais (Royaume-Uni, Colemak-DH)Anglais (Royaume-Uni, Dvorak)Anglais (Royaume-Uni, Dvorak, ponctuation britannique)Anglais (Royaume-Uni, Macintosh)Anglais (Royaume-Uni, Macintosh, international)Anglais (Royaume-Uni, Sun type 6/7)Anglais (Royaume-Uni, étendu, Windows)Anglais (Royaume-Uni, internat., avec touches mortes)Anglais (US)Anglais (US, Arabe IBM 238_L)Anglais (US, Sun type 6/7)Anglais (US, symbolique)Anglais (US, variante internat.)Anglais (US, Euro sur le 5)Anglais (US, international, combinatoire Unicode via AltGr)Anglais (US, international, combinatoire Unicode via AltGr, variante)Anglais (US, internat., avec touches mortes)Anglais (Workman)Anglais (Workman, internat., avec touches mortes)Anglais (Dvorak classique)Anglais (internat., touches mortes via AltGr)Anglais (Dvorak pour programmeur)Anglais (diviser/multiplier bascule la disposition)Ennyah DKB-1008Entrée sur le pavé numériqueEspérantoEspéranto (Brésil, Nativo)Espéranto (Portugal, PT-Nativo)Espéranto (obsolète)Lettres espéranto avec exposantsEstonienEstonien (Dvorak)Estonien (Sun type 6/7)Estonien (US)Estonien (sans touche morte)EurKEY (US)Euro sur le 2Euro sur le 4Euro sur le 5Euro sur le EEverex STEPnoteÉwéFL90FéroïenFéroïen (sans touche morte)FilipinoFilipino (Capewell-Dvorak, baybayin)Filipino (Capewell-Dvorak, latin)Filipino (Capewell-QWERF 2006, baybayin)Filipino (Capewell-QWERF 2006, latin)Filipino (Colemak, baybayin)Filipino (Colemak, latin)Filipino (Dvorak, baybayin)Filipino (Dvorak, latin)Filipino (QWERTY, baybayin)FinnoisFinnois (DAS)Finnois (Dvorak)Finnois (Macintosh)Finnois (Sun type 6/7)Finnois (Windows)Finnois (classique)Finnois (classique, sans touche morte)Touche à quatre niveaux avec le séparateur décimal abstraitTouche à quatre niveaux avec virguleTouche à quatre niveaux avec pointTouche à quatre niveaux avec point, Latin-9 uniquementTouche à quatre niveaux avec le séparateur décimal momayyezFrançaisFrançais (AZERTY)Français (AZERTY, AFNOR)Français (BÉPO)Français (BÉPO, AFNOR)Français (BÉPO, Latin-9 uniquement)Français (breton)Français (Cameroun)Français (Canada)Français (Canada, Dvorak)Français (Canada, obsolète)Français (République démocratique du Congo)Français (Dvorak)Français (Macintosh)Français (Mali, variante)Français (Maroc)Français (Sun type 6/7)Français (Suisse)Français (Suisse, Macintosh)Français (Suisse, Sun type 6/7)Français (Suisse, sans touche morte)Français (Togo)Français (US avec touches mortes, variante)Français (US)Français (US, AZERTY)Français (variante)Français (variante, Latin-9 uniquement)Français (variante, sans touche morte)Français (obsolète, variante)Français (obsolète, variante, sans touche morte)Français (sans touche morte)Frioulan (Italie)Fujitsu-Siemens Amilo (portable)PeulGaPC générique 101 touchesPC générique 102 touchesPC générique 104 touchesPC générique 104 touches avec touche Entrée en LPC générique 105 touchesPC générique 86 touchesGenius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGéorgienGéorgien (France, AZERTY Tskapo)Géorgien (Italie)Géorgien (MESS)Géorgien (ergonomique)AllemandAllemand (Aus der Neo-Welt)Allemand (Autriche)Allemand (Autriche, Macintosh)Allemand (Autriche, sans touche morte)Allemand (Bone)Allemand (Bone, ß dans la rangée du milieu)Allemand (Dvorak)Allemand (E1)Allemand (E2)Allemand (KOY)Allemand (Ladin)Allemand (Macintosh)Allemand (Macintosh, sans touche morte)Allemand (Neo 2)Allemand (Neo, QWERTY)Allemand (Neo, QWERTZ)Allemand (QWERTY)Allemand (Sun type 6/7)Allemand (Suisse)Allemand (Suisse, Macintosh)Allemand (Suisse, Sun type 6/7)Allemand (Suisse, obsolète)Allemand (Suisse, sans touche morte)Allemand (T3)Allemand (US)Allemand (accent aigu en touche morte)Allemand (accents aigu et grave en touches mortes)Allemand (tilde en touche morte)Allemand (sans touche morte)Allemand (avec lettres hongroises, sans touche morte)Allemand, suédois et finnois (US)GrecGrec (Colemak)Grec (Sun type 6/7)Grec (étendu)Grec (sans touche morte)Grec (polytonique)Grec (simple)GujarâtîGyrationHanyu Pinyin (touches mortes via AltGr)Happy HackingHappy Hacking pour MacHaoussa (Ghana)Haoussa (Nigeria)HawaïenHébreuHébreu (biblique, SIL, phonétique)Hébreu (biblique, Tiro)Hébreu (lyx)Hébreu (phonétique)Hewlett-Packard InternetHewlett-Packard Mini 110 (portable)Hewlett-Packard NEC SK-2500 MultimédiaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadécimalHindi (Bolnagri)Hindi (KaGaPa, phonétique)Hindi (Wx)Honeywell EuroboardHongroisHongrois (QWERTY)Hongrois (QWERTY, 101 touches, virgule, touches mortes)Hongrois (QWERTY, 101 touches, virgule, sans touche morte)Hongrois (QWERTY, 101 touches, point, touches mortes)Hongrois (QWERTY, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (QWERTZ, 101 touches, virgule, touches mortes)Hongrois (QWERTZ, 101 touches, virgule, sans touche morte)Hongrois (QWERTZ, 101 touches, point, touches mortes)Hongrois (QWERTZ, 101 touches, point, sans touche morte)Hongrois (QWERTZ, 102 touches, virgule, touches mortes)Hongrois (QWERTZ, 102 touches, virgule, sans touche morte)Hongrois (QWERTZ, 102 touches, point, touches mortes)Hongrois (QWERTZ, 102 touches, point, sans touche morte)Hongrois (sans touche morte)Hongrois (standard)Hyper est placé sur les touches WindowsIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandaisIslandais (Dvorak)Islandais (Macintosh)Islandais (Macintosh, obsolète)IgboIndienIndic IPAIndonésien (Arabe pégon, phonétique étendue)Indonésien (Javanais)Indonésien (Latin)Alphabet phonétique internationalAlphabet phonétique international (QWERTY)InuktitutIrakienIrlandaisIrlandais (UnicodeExpert)ItalienItalien (Dvorak)Italien (IBM 142)Italien (Ladin)Italien (Macintosh)Italien (Sun type 6/7)Italien (US)Italien (Windows)Italien (internat., avec touches mortes)Italien (sans touche morte)JaponaisJaponais (Dvorak)Japonais (Kana 86)Japonais (Kana)Japonais (Macintosh)Japonais (OADG 109A)Japonais (PC-98)Japonais (Sun type 6)Japonais (Sun type 7, compatible PC)Japonais (Sun type 7, compatible Sun)Options des claviers japonaisKabyle (AZERTY, avec touches mortes)Kabyle (QWERTY, Royaume-Uni, avec touches mortes)Kabyle (QWERTY, US, avec touches mortes)KalmykLa touche « verrouillage Kana » verrouilleKannadaKannada (KaGaPa, phonétique)CachoubeKazakhKazakh (latin)Kazakh (étendu)Kazakh (avec russe)Séquence de touches pour tuer le serveur XTouche sélectionnant le niveau 5Touche sélectionnant le niveau 2Touche sélectionnant le niveau 3Keytronic FlexProKhmer (Cambodge)KikuyuKinesisKomiCoréenCoréen (compatible 101/104 touches)Coréen (Sun type 6/7)Touches Hangeul/Hanja coréennesKurde (Iran, arabe-latin)Kurde (Iran, F)Kurde (Iran, Alt-Q latin)Kurde (Iran, Q latin)Kurde (Irak, arabe-latin)Kurde (Irak, F)Kurde (Irak, Alt-Q latin)Kurde (Irak, Q latin)Kurde (Syrie, F)Kurde (Syrie, Alt-Q latin)Kurde (Syrie, Q latin)Kurde (Turquie, F)Kurde (Turquie, Alt-Q latin)Kurde (Turquie, Q latin)KutenaiKirghizeKirghize (phonétique)LaoLao (STEA)LettonLetton (Colemak)Letton (Colemak, avec apostrophe)Letton (Dvorak)Letton (Dvorak, avec Y)Letton (Dvorak, avec moins)Letton (F)Letton (Sun type 6/7)Letton (adapté)Letton (apostrophe)Letton (apostrophe, guillemets en touches mortes)Letton (ergonomique, ŪGJRMV)Letton (moderne)Letton (Dvorak pour le programmeur)Letton (Dvorak pour le programmeur, avec Y)Letton (Dvorak pour le programmeur, avec moins)Letton (tilde)Disposition du pavé numériqueAlt gaucheAlt gauche (maintenu)Alt. gauche pour Ctrl, Ctrl pour Win, Win gauche pour Alt. gaucheAlt gauche échangé avec Windows gaucheAlt gauche+Maj. gaucheCtrl gaucheCtrl gauche comme MétaCtrl gauche (première disposition), Ctrl droit (dernière disposition)Ctrl gauche+Maj. gaucheCtrl gauche + Windows gaucheCtrl gauche + Windows gauche (première disposition), Ctrl droit + Menu (seconde disposition)Maj. gaucheTouche Windows gaucheWindows gauche (maintenu)Windows gauche sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauTouche Windows gauche (première disposition), touche Windows droite (dernière disposition)ObsolèteWang 724 (obsolète)Touche obsolète avec virguleTouche obsolète avec pointLituanienLituanien (Dvorak)Lituanien (IBM LST 1205-92)Lituanien (LEKP)Lituanien (LEKPa)Lituanien (Ratise)Lituanien (Sun type 6/7)Lituanien (US)Lituanien (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (variante)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (variante 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTouches supplémentaires Logitech G15 via le démon G15Logitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE (USB)Bas-sorabeBas-sorabe (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (Internat.)MacédonienMacédonien (sans touche morte)MacintoshMacintosh (ancien)Faire de Verr. maj. un Effacement. arrière supplémentaire.Faire de Verr. maj. un Ctrl supplémentaire.Faire de Verr. maj. un Échap. supplémentaire.Faire de Verr. maj. un Échap. supplémentaire, mais Maj. + Verr. maj. a l'effet du Verr. maj. habituelFaire de Verr. maj. un Hyper supplémentaireFaire de Verr. maj. une touche Menu supplémentaire.Faire de Verr. maj. un Verr. Num. supplémentaireFaire de Verr. maj. un Super supplémentaire.Faire du Zenkaku Hankaku un Échap. supplémentaire.Alt. droite comme touche hangeulAlt. droite comme touche hanjaCtrl. droite comme touche hangeulCtrl. droite comme touche hanjaMalais (clavier jawi, arabe)Malais (jawi, phonétique)MalayâlamMalayâlam (lalitha)Malayâlam (InScript amélioré avec le roupie)MaltaisMaltais (Royaume-Uni, surcharges via AltGr)Maltais (US)Maltais (US, surcharges via AltGr)Meitei (Eeyek)MaoriMarathe (KaGaPa, phonétique)Marathe (InScript amélioré)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (maintenu), Maj.+Menu pour MenuMenu comme Ctrl droiteMenu sélectionne le niveau 5Menu est placé sur les touches WindowsMéta est placé sur Windows gaucheMéta est placé sur les touches WindowsMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (suédois)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB /Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Clavier Microsoft OfficeMicrosoft SurfaceMicrosoft Wireless Multimedia 1.0AM'mockModi (phonétique KaGaPa)MoldaveMoldave (Gagaouze)MongolMongol (bichig)Mongol (galik)Mongol (galik mandchou)Mongol (mandchou)Mongol (galik todo)Mongol (todo)Mongol (xibe)MonténégrinMonténégrin (cyrillique)Monténégrin (cyrillique, ZE et ZHE intervertis)Monténégrin (cyrillique, avec guillemets)Monténégrin (latin, QWERTY)Monténégrin (latin, Unicode)Monténégrin (latin, Unicode, QWERTY)Monténégrin (latin, avec guillemets)Multilingue (Canada, Sun type 6/7)N'Ko (AZERTY)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Eff. Arr. du type NICOLA-FNépalaisEspace insécable au niveau 2Espace insécable au niveau 3Espace insécable au niveau 3, rien au niveau 4Espace insécable au niveau 3, espace fine insécable au niveau 4Espace insécable au niveau 4Espace insécable au niveau 4, espace fine insécable au niveau 6Espace insécable au niveau 4, espace fine insécable au niveau 6 (via Ctrl+Maj.)Entrée d'une espace insécableSami du Nord (Finlande)Sami du Nord (Norvège)Sami du Nord (Norvège, sans touche morte)Sami du Nord (Suède)Northgate OmniKey 101NorvégienNorvégien (Colemak)Norvégien (Dvorak)Norvégien (Macintosh)Norvégien (Macintosh, sans touche morte)Norvégien (Sun type 6/7)Norvégien (Windows)Norvégien (sans touche morte)Verr. Num.Verr. num. activé : chiffres ; maj. pour les flèches. Verr. num. désactivé : flèches (comme Windows)Touche numérique 4 pour un appui isoléTouche numérique 9 pour un appui isoléComportement de la touche de Suppr. du pavé numériqueLes touches du pavé numérique sont toujours numériques (comme sur Mac OS)OLPCOccitanOghamOgham (IS434)SantaliRunes HongroisesAncien hongrois (pour les ligatures)Compatibilité avec les anciens codes des touches SolarisTurc ancienTurc ancien (F)OriyaOriya (Bolnagri)Oriya (Wx)Ortek MCK-800 Multimédia/InternetOssète (Géorgie)Ossète (Windows)Ossète (obsolète)Turc ottomanTurc ottoman (F)PC-98Ruthène pannonienPosition des parenthèsesPachtoPachto (Afghanistan, OLPC)PausePersanPersan (Afghanistan, Dari, OLPC)Persan (avec pavé numérique persan)Type DAB ou téléphonePolonaisPolonais (clavier anglais)Polonais (Colemak)Polonais (Colemak-DH)Polonais (Dvorak)Polonais (Dvorak, guillemets polonais sur le 1)Polonais (Dvorak, guillemets polonais sur la touche guillemets)Polonais (Allemagne, sans touche morte)Polonais (glagolitique)Polonais (QWERTZ)Polonais (Sun type 6/7)Polonais (internat., avec touches mortes)Polonais (gaucher)Polonais (obsolète)Polonais (Dvorak pour le programmeur)PortugaisPortugais (Brésil)Portugais (Brésil, Dvorak)Portugais (Brésil, ThinkPad IBM/Lenovo)Portugais (Brésil, Nativo pour claviers US)Portugais (Brésil, Nativo)Portugais (Brésil, Sun type 6/7)Portugais (Brésil, sans touche morte)Portugais (Colemak)Portugais (Macintosh)Portugais (Macintosh, sans touche morte)Portugais (Nativo pour claviers US)Portugais (PT-Nativo)Portugais (Sun type 6/7)Portugais (sans touche morte)Position de la touche ComposePropeller Voyager KTEZ-1000Impr. Écr.Penjabi (Gurmukhî, Jhelum)Penjabi (Gurmukhî)QTronix Scorpius 98N+Alt droiteAlt droite (maintenu)Alt droite sélectionne le niveau 5Alt. droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauAlt droite ne sélectionne jamais le niveau 3Alt droite, Maj. + Alt droite est la touche composeCtrl droiteCtrl droite (maintenu)Ctrl droite comme Alt droiteCtrl droite + Maj. droiteMaj. droiteWindows droiteWindows droite (maintenu)Windows droite sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauRoumainRoumain (Allemagne)Roumain (Allemagne, sans touche morte)Roumain (Sun type 6/7)Roumain (Windows)Roumain (ergonomique dactylographique)Roumain (standard)Roupie sur le 4RusseRusse (Biélorusse)Russe (Tchèque, phonétique)Russe (DOS)Russe (GOST 14289-88)Russe (GOST 6431-75, 48 touches)Russe (Géorgie)Russe (Allemagne, phonétique)Russe (Allemagne, recommandé)Russe (Allemagne, translittération)Russe (Kazakhstan, avec kazakh)Russe (Macintosh)Russe (Pologne, Dvorak phonétique)Russe (polyglotte et réactionnaire)Russe (Rulemak, Colemak phonétique)Russe (Sun type 6/7)Russe (Suède, phonétique)Russe (Suède, phonétique, sans touche morte)Russe (US, phonétique)Russe (Ukraine, RSTU standard)Russe (obsolète)Russe (Macintosh phonétique)Russe (phonétique)Russe (phonétique, AZERTY)Russe (phonétique, Dvorak)Russe (phonétique, français)Russe (phonétique, Windows)Russe (phonétique, YAZHERTY)Russe (machine à écrire)Russe (machine à écrire, obsolète)Russe (avec ponctuation US)Russe (Ukrainien-Biélorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taïwan)SamogitienSamsung SDM 4500PSamsung SDM 4510PSanscrit (KaGaPa, phonétique)Symboles sanscritSanwa Supply SKB-KG3Arrêt défilementSecwepemctsinPoint-virgule au niveau 3SerbeSerbe (cyrillique, ZE et ZHE intervertis)Serbe (cyrillique, avec guillemets)Serbe (Latin)Serbe (Latin, QWERTY)Serbe (latin, Unicode)Serbe (latin, Unicode, QWERTY)Serbe (Latin, avec guillemets)Serbe (Russe)Serbe (accents combinatoires à la place des touches mortes)Serbo-Croate (US)Maj. + VerrNum bascule le contrôle souris au clavier (PointerKeys) Maj. annule Verr. maj.Maj. n'annule pas Verr. num., mais sélectionne le niveau 3Maj.+ Verr. maj.SicilienSicilien (clavier US)SilésienSilvercrest Multimedia WirelessSindhîCingalais (US)Cingalais (phonétique)SlovaqueSlovaque (disposition ACC, lettres accentuées uniquement)Slovaque (QWERTY)Slovaque (QWERTY, barre oblique inverse étendue)Slovaque (Sun type 6/7)Slovaque (barre oblique inverse étendue)SlovèneSlovène (US)Slovène (avec guillemets)EspagnolEspagnol (Dvorak)Espagnol (Amérique latine)Espagnol (Amérique latine, Colemak spécial jeux)Espagnol (Amérique latine, Colemak)Espagnol (Amérique latine, Dvorak)Espagnol (Amérique latine, tilde en touche morte)Espagnol (Amérique latine, sans touche morte)Espagnol (Macintosh)Espagnol (Sun type 6/7)Espagnol (Windows)Espagnol (tilde en touche morte)Espagnol (sans touche morte)Les combinaisons spéciales (Ctrl+Alt+<touche>) sont traitées par le serveur XSteelSeries Apex 300 (Apex RAW)Sun type 6 (Japon)Sun type 6 USB (Japon)Sun type 6 USB (Unix)Sun type 6/7 USBSun type 6/7 USB (Europe)Sun type 7 USBSun type 7 USB (Europe)Sun type 7 USB (Japon)/Japonais 106 touchesSun type 7 USB (Unix)Compatibilité avec les touches SunSuper Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Intervertir Ctrl et Verr. maj.Intervertir Échap. et Verr. maj.Échange Alt. gauche et Ctrl gaucheÉchange Win gauche et Ctrl gaucheÉchange Win droite et Ctrl droiteÉchangé avec les crochetsSuédoisSuédois (Dvorak A5)Suédois (Dvorak)Suédois (Dvorak, international)Suédois (Macintosh)Suédois (Sun type 6/7)Suédois (Svdvorak)Suédois (US)Suédois (sans touche morte)Langue des signes suédoisePassage à une autre dispositionSymplon PaceBook (tablette)SyriaqueSyriaque (phonétique)TaïwanaisTaïwanais (indigène)TadjikTadjik (obsolète)Tamoul (InScript)Tamoul (Sri Lanka, TamilNet '99)Tamoul (Sri Lanka, TamilNet '99, codage TAB)Tamoul (TamilNet '99 avec chiffres tamouls)Tamoul (TamilNet '99)Tamoul (TamilNet '99, codage TAB)Tamoul (TamilNet '99, codage TSCII)Targa Visionary 811TatarTélougouTélougou (KaGaPa, phonétique)Télougou (Sarala)ThaïThaï (Pattachote)Thaï (TIS-820.2538)La touche « < > »La touche « < > » sélectionne le niveau 5La touche « < > » sélectionne le niveau 5 ; avec un autre sélecteur de niveau 5, verrouille une fois ce niveauLa touche « < > », avec un autre sélecteur de niveau 3, verrouille une fois ce niveauTibétainTibétain (avec chiffres ASCII)À gauche du « A »Toshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcTurc (Alt-Q)Turc (F)Turc (Allemagne)Turc (Sun type 6/7)Turc (internat., avec touches mortes)TurkmèneTurkmène (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (mode 102/105:EU)TypeMatrix EZ-Reach 2030 USB (mode 106:JP)OudmourteOugaritique à la place de l'arabeUkrainienUkrainien (Sun type 6/7)Ukrainien (Windows)Ukrainien (homophonique)Ukrainien (obsolète)Ukrainien (phonétique)Ukrainien (RSTU standard)Ukrainien (machine à écrire)Opérateurs mathématiques et flèches UnicodeOpérateurs mathématiques et flèches Unicode au niveau par défautUnitek KB-1925Ourdou (Navees)Ourdou (Navees, Pakistan)Ourdou (Pakistan)Ourdou (Pakistan, CRULP)Ourdou (Pakistan, NLA)Ourdou (Windows)Ourdou (variante phonétique)Ourdou (phonétique)Utiliser les LED clavier pour indiquer les modificateursUtiliser les LED clavier pour indiquer une disposition alternativeL'espace habituelle quel que soit le niveauOuïghourOuzbekOuzbek (Afghanistan)Ouzbek (Afghanistan, OLPC)Ouzbek (latin)VietnamienVietnamien (AÐERTY)Vietnamien (français)Vietnamien (QĐERTY)Vietnamien (US)ViewSonic KU-306 InternetPavé Wang 724 avec opérateurs mathématiques et flèches UnicodePavé Wang 724 avec opérateurs mathématiques et flèches Unicode au niveau par défautLa touche Windows est placé sur Impr. écr. (en plus de la touche Windows)Windows+EspaceWinbook Model XP5WolofYahoo! InternetIakuteYorubaAntiliant sans chasse au niveau 2Antiliant sans chasse au niveau 2. espace insécable au niveau 3Antiliant sans chasse au niveau 2, espace insécable au niveau 3, rien au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, espace fine insécable au niveau 4Antiliant sans chasse au niveau 2. espace insécable au niveau 3, liant sans chasse au niveau 4Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3Antiliant sans chasse au niveau 2, liant sans chasse au niveau 3, espace insécable au niveau 4Antiliant sans chasse au niveau 3, liant sans chasse au niveau 4akamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcspersonnalisédadede_llddlgdvdzeMachines m6800 (portable)eeeneoeseteufafffifofrfr-tggaagaggrguhahawhehihrhuhyidieigikeinisitit_lldjajvkakabkikkkmknkokukutloltlvmdmimkmlmnmrmsmtmynenlnooldhunoldhun(lig)orpaphplpsptrorusasassatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzh@